KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_37811Help
Entry
Y11_37811         CDS       T02010                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Y11_37811
   00500 Starch and sucrose metabolism
    Y11_37811
Enzymes [BR:yey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Y11_37811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3927664..3928749
Genome map
AA seq 361 aa AA seqDB search
MPINLLGKTLLLGLISFAVLGTVNAAQYNAVVSTSPQGDEFSSINAALKSAPMDDTPFII
FLKNGVYTERLEVARSHVTLKGENRDGTVIGANTAAGMLNPQGEKWGTSGSSTVLVNAPN
FTAENLTIRNDFDFPANKKKADTDPTKLKDTQAVALLLAENSDKARFKAVKLEGYQDTLY
SKTGSRSYFSDCEISGHVDFIFGSGITVFDNCNIVARDRSDIEPPYGYITAPSTLTTSPY
GLIFINSRLTKEPGVPANSFALGRPWHPTTTFADGRYADPAAIGQSVFINTTMDDHIYGW
DKMSGKDKQGEKIWFYPQDSRFFEANSQGPGAAINEGRRQLSAEQLKAFTLPMIFPDWAV
H
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaatttattgggtaaaacgctattgttaggattaatatcatttgctgtattg
gggacggtgaatgcagcgcagtataatgcagttgtttctacctctcctcagggagacgag
ttttcctcgattaatgctgcattgaagtcagctccgatggatgacactccttttattatt
ttcctgaaaaatggagtttatactgaaaggctcgaggtggctcgtagtcatgtcaccctc
aaaggagagaaccgcgatggcacggtgatcggtgccaatactgcggcggggatgctcaat
ccacaaggcgaaaaatggggaacttccggcagtagtactgtgctggttaatgctccgaac
tttacagctgaaaatctgactattcgtaatgattttgattttccagccaataaaaagaaa
gcggatactgacccaacaaaattaaaagatactcaagcggtggcactattattagccgaa
aatagtgataaagcgcgtttcaaggcagtgaaacttgaaggttaccaggatacgctttat
agcaaaaccggcagccggagttatttctccgactgtgaaattagtggtcatgttgatttt
atttttggctcaggaatcacggtatttgataattgtaatatcgtggcgcgtgatcgaagt
gatattgagccgccttatggctatatcacggccccgagtacattaacgacctcgccttat
ggtttgatatttattaacagccgattgaccaaagagccaggtgttcccgctaatagtttt
gctttaggacgtccatggcacccgacaaccacttttgcggatggccgttatgccgatccg
gcagcaataggtcagtcggtatttatcaatacgacgatggatgatcatatttacggttgg
gataaaatgtctggcaaagataaacaaggcgagaaaatttggttctatccgcaagattca
cgtttctttgaggcaaatagtcaggggccgggagcagcaattaacgagggacgccgccag
ttatctgcggagcaacttaaagctttcacattacctatgattttccctgactgggccgtg
cattga

DBGET integrated database retrieval system