KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_37971Help
Entry
Y11_37971         CDS       T02010                                 

Definition
DNA polymerase III psi subunit (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Y11_37971
   00240 Pyrimidine metabolism
    Y11_37971
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Y11_37971
   03430 Mismatch repair
    Y11_37971
   03440 Homologous recombination
    Y11_37971
Enzymes [BR:yey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Y11_37971
DNA replication proteins [BR:yey03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Y11_37971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3947441..3947878
Genome map
AA seq 145 aa AA seqDB search
MASRRDLLLQQLGITQWTLRRPAVLQGEIAIRLPDDTRLLIVADPLPEQDDPLLCDVLHC
LGLNPHQAYALTPDQVAMLPEETQCNSWRLGISEPLAVAGAQLYSPALTGLYQDASAKRA
LWQQICHHEADFYPDASRSGHRVPN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagacgagacttactgttacaacagctgggtattacgcagtggacattgcgt
cgcccggccgttttgcaaggtgaaattgccatacgtttacctgatgatacccgcctgtta
attgtcgcagatccgcttcctgagcaggatgacccgctgttgtgcgatgtgttgcactgc
cttgggctaaatccgcatcaggcctatgcgctgacgccggatcaggtggcaatgttaccc
gaagagacacagtgcaacagttggcgattgggcatcagtgaaccgcttgcggttgcgggt
gcgcaattatacagcccggccctgaccggactttatcaagacgcgagcgctaagcgcgca
ctttggcagcagatttgtcatcatgaagcagatttctatcctgacgccagccgatctggc
caccgcgtaccaaattga

DBGET integrated database retrieval system