KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_38061Help
Entry
Y11_38061         CDS       T02010                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Y11_38061
Enzymes [BR:yey01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Y11_38061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3956263..3957618
Genome map
AA seq 451 aa AA seqDB search
MLLLFHKQGDTLFLAQEIIRKKRDGQVLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFH
DMSMPERVALTMAMRDSGTVLNWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYV
PMISGRGLGHTGGTLDKLEAIPGFDIFPDDSAFRKIIQDVGVAIIGQTSSLAPADKRFYA
TRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYQLSEDLAKAIVSVAN
GAGCKTTALLTDMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGL
AQNDADARAKLQAVLDNGKAAEIFGRMVAAQKGPSDFVERNDSYLPAAMLSKPVFAERPG
IITAMDTRALGMAVVSLGGGRRRATDPIDYSVGLTDMARLGASVDGQQPLAVIHANNEDD
WQQAADAVRAAITLGQKAAEETPVVYRRITE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcttttatttcataagcagggggataccttgtttctcgcacaagaaattatccgt
aaaaaacgcgacggccaggtactgagcgaagaagagattcgtttctttattaatggcatt
cgcgataacgtggtttccgaagggcaaattgccgctctggcgatgaccatttatttccat
gatatgagcatgccagaacgtgtggcgctcactatggcaatgcgtgattctggcaccgtg
ctgaactggaagagcctaaaccttaatggcccgattgtggacaagcactccaccggcggc
gtgggtgatgtgacttccttgatgctcggcccaatggtagcggcctgcggcggctatgta
ccgatgatctcgggtcgtggcttgggtcatactggcggaacattggacaaactggaagcg
attcctggttttgatattttccccgacgacagtgcctttcgcaaaatcattcaggatgtc
ggcgtcgctattatcggccaaaccagctcgctggcaccggcggataagcgcttttatgcc
acccgcgatatcaccgctacagtagattctatcccgctgattaccgcttctattctggct
aaaaagctggctgaagggttggatgcgttggtgatggatgtcaaagtggggtcgggtgct
tttatgccgacttatcagctgtctgaggacttggccaaggccattgtcagtgtcgctaat
ggcgcgggttgtaaaaccaccgcgctgttgactgacatgaatcaggtattggcgtccagt
gccggtaatgcggttgaagtgcgcgaagcggtgcgtttcctgactggcgaatatcgtaac
ccgcgtctgttggaagtgactatggcgctgtgtgtcgagatgctgctatccggcggcttg
gcgcaaaatgacgccgatgctcgtgctaagctgcaagcagtattggataacggcaaagcg
gcggaaatcttcggtcgcatggtcgctgcgcaaaaaggcccgagcgattttgtcgaacgc
aatgacagttacttgcccgctgccatgttaagcaaacccgtgtttgctgaacggccagga
attatcactgctatggatacccgagcattaggtatggccgtagtttcccttggcggtggt
cgccgtcgagcaactgatcctattgactacagtgtgggcctgaccgatatggcccgcttg
ggtgccagtgttgatggtcaacagccattagcggtgattcatgccaacaatgaagatgac
tggcagcaggcagcagatgcagtacgtgcggcaatcacattaggccaaaaagcagcggaa
gaaaccccggtggtttatcgccgtattactgaataa

DBGET integrated database retrieval system