KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_38331Help
Entry
Y11_38331         CDS       T02010                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00260  Glycine, serine and threonine metabolism
yey00750  Vitamin B6 metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01230  Biosynthesis of amino acids
Module
yey_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Y11_38331
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Y11_38331
Enzymes [BR:yey01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Y11_38331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CBY28697
UniProt: A0A0H3P0N0
Position
3987934..3989223
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILS
AFIGNEIAPDVLTKRVQAAFEFPAPVAQVENDIAALELFHGPTLAFKDFGARFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIEGDFDACQALVKQAFDDEELKQALSLNSANSINISRLLAQICYYFEAVAQLPQDARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNA
MDVSQPNNWLRVEELYRRKIWQLKELGHGAVSDDITEDTMRELAELGYISEPHAAIAYRV
LRDQLQDGEFGVFIATAHPAKFKESVEEILAQELPLPKPLAVRAQLPLLSHDLPADFAQL
RTFLMALPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataaccttaaagatcacaacgagcaggtcagcttcgcgcaagcgattaaa
cagggcctgggcaagcagcaagggttgttcttcccgctggagttgccagagtttgaactg
acagaaattgataaactgctggatctggattttgtcactcgcagcagccgtattctttct
gcttttattggtaatgaaattgcaccagatgtgttaaccaaacgcgttcaggcggcgttt
gagtttccggctccagtcgctcaggttgagaatgatatcgccgcactggagttgttccac
ggcccgacattggcctttaaggacttcggcgcacgttttatggcacaaatgctggccgaa
gtggctggcgaccagccagtgactatcttaaccgcaacctctggtgatactggggcggcg
gtcgctcatgctttctatggcttgaaaaatgtccgcgtggttatcctctatccacgcggc
aaaatcagcccgctgcaagagaagctgttctgtacgttaggtggcaatatccacacggtg
gctattgagggcgattttgatgcttgtcaggcgctggtcaaacaagcctttgatgatgag
gagttaaagcaggcgctgagccttaactctgctaactccattaatatcagccgcttgctg
gctcaaatttgctattacttcgaagctgtagcccagttaccgcaagacgcgcgtaaccaa
ttggttatctccgtgccaagtggcaacttcggtgatttgaccgccggtttgctggcaaaa
tcgttaggtttgccggtaaaacgctttatcgctgccactaatgccaacgacaccgtgccg
cgcttcctggttaacggccagtggcagccgaagccgacggtggcgacgttatcgaatgct
atggatgtcagccagccgaataactggctgcgtgttgaggagctttatcgtcgtaaaatc
tggcagttgaaagaattgggccacggcgcagtcagtgatgatatcaccgaagacaccatg
cgcgaattggcggagttagggtatatctcagagcctcatgctgctattgcctatcgtgtg
ttgcgcgatcaattgcaggacggagaattcggggtatttatcgcgacagcgcatccggcg
aaattcaaagaaagtgtagaagagattctggcgcaggaattgccactgccaaaaccactg
gcggtgcgagcgcaattgccattgttatcccatgatttaccagcagattttgcacaatta
cgcactttcttgatggcgttaccgaaataa

DBGET integrated database retrieval system