KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_38331Help
Entry
Y11_38331         CDS       T02010                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:yey01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:yey00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:yey00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3987934..3989223
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILS
AFIGNEIAPDVLTKRVQAAFEFPAPVAQVENDIAALELFHGPTLAFKDFGARFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIEGDFDACQALVKQAFDDEELKQALSLNSANSINISRLLAQICYYFEAVAQLPQDARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNA
MDVSQPNNWLRVEELYRRKIWQLKELGHGAVSDDITEDTMRELAELGYISEPHAAIAYRV
LRDQLQDGEFGVFIATAHPAKFKESVEEILAQELPLPKPLAVRAQLPLLSHDLPADFAQL
RTFLMALPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataaccttaaagatcacaacgagcaggtcagcttcgcgcaagcgattaaa
cagggcctgggcaagcagcaagggttgttcttcccgctggagttgccagagtttgaactg
acagaaattgataaactgctggatctggattttgtcactcgcagcagccgtattctttct
gcttttattggtaatgaaattgcaccagatgtgttaaccaaacgcgttcaggcggcgttt
gagtttccggctccagtcgctcaggttgagaatgatatcgccgcactggagttgttccac
ggcccgacattggcctttaaggacttcggcgcacgttttatggcacaaatgctggccgaa
gtggctggcgaccagccagtgactatcttaaccgcaacctctggtgatactggggcggcg
gtcgctcatgctttctatggcttgaaaaatgtccgcgtggttatcctctatccacgcggc
aaaatcagcccgctgcaagagaagctgttctgtacgttaggtggcaatatccacacggtg
gctattgagggcgattttgatgcttgtcaggcgctggtcaaacaagcctttgatgatgag
gagttaaagcaggcgctgagccttaactctgctaactccattaatatcagccgcttgctg
gctcaaatttgctattacttcgaagctgtagcccagttaccgcaagacgcgcgtaaccaa
ttggttatctccgtgccaagtggcaacttcggtgatttgaccgccggtttgctggcaaaa
tcgttaggtttgccggtaaaacgctttatcgctgccactaatgccaacgacaccgtgccg
cgcttcctggttaacggccagtggcagccgaagccgacggtggcgacgttatcgaatgct
atggatgtcagccagccgaataactggctgcgtgttgaggagctttatcgtcgtaaaatc
tggcagttgaaagaattgggccacggcgcagtcagtgatgatatcaccgaagacaccatg
cgcgaattggcggagttagggtatatctcagagcctcatgctgctattgcctatcgtgtg
ttgcgcgatcaattgcaggacggagaattcggggtatttatcgcgacagcgcatccggcg
aaattcaaagaaagtgtagaagagattctggcgcaggaattgccactgccaaaaccactg
gcggtgcgagcgcaattgccattgttatcccatgatttaccagcagattttgcacaatta
cgcactttcttgatggcgttaccgaaataa

DBGET integrated database retrieval system