KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_39001Help
Entry
Y11_39001         CDS       T02010                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Y11_39001
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Y11_39001
Enzymes [BR:yey01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Y11_39001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4073589..4075079
Genome map
AA seq 496 aa AA seqDB search
MADRNLRDLLAPWGLDAPERALREMTLDSRVAAAGDLFVAIVGHQTDGRRYIPQAIAQGV
AAVVAEADGVAPDASMVEMHGVPVIYLRNLNQHLSKLAGQFYHQPGAALRLVGVTGTNGK
TTTTQLLAQWAKMLGETSAVMGTVGNGLLGQVIPTENTTGSAVDIQHLLRNLVDQGATFA
AMEVSSHGLIQNRVAALPFAAAVFTNLSRDHLDYHGNMASYEAAKWLLFSTHQSEHKIIN
ADDEVGRRWLGQLPQAVAVSMENNIPVGWNGPWLSASQVHYHDNGASIAFDSSWGESQLE
SRLMGAFNVSNLLVALATLLSLGYPLTQLLAAAPHLQPVCGRMEVFNAPGKPTVVVDYAH
TPDALEKALVAARLHCKGQLWCVFGCGGDRDKGKRPLMGGIAEQLADRVVVTDDNPRSEE
PQAIVADILSGLLDAGHAQAIHGRAEAVTSAIMQAKADDVVLIAGKGHEDYQLVGNRRLD
YSDRVTVARLLGGWHD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgacttactcgctccttgggggctagacgccccggagcgt
gcgctacgggaaatgacattagacagccgtgttgccgctgccggggatttatttgtcgct
attgtcggccaccagacggacgggcgtcgctatatcccgcaagccatcgctcaaggtgtg
gcggctgtggttgctgaagctgatggtgtggctccggatgcaagtatggtcgagatgcat
ggtgttccagttatatatctgcgtaatttgaatcagcacttatccaagctggcgggacaa
ttttaccatcagccgggtgccgcattacgtttggtcggtgtgacgggaaccaatggtaaa
accaccaccactcaattgctggcacaatgggctaagatgttgggcgaaaccagcgcagtg
atggggacggttggcaatggtctgttaggccaggttatcccgactgaaaacaccaccggc
tcagcggttgatatccagcatttgctacgcaatctggttgaccaaggggcgacttttgcc
gcgatggaagtctcctcccatggtttgattcagaaccgcgtagccgcattgccgtttgct
gccgcagtgttcactaacttaagccgtgatcatctggattatcacggcaatatggcgagt
tacgaagcagcaaaatggctgctgttctccacccatcagtcagagcataaaattattaat
gctgatgacgaagtcggccgccgctggttagggcagctgccgcaagctgtcgccgtcagc
atggaaaacaatattcctgtgggttggaatggcccatggctctccgccagccaagttcat
tatcacgataatggtgccagtatcgcgtttgattcaagctggggcgaaagccagttagaa
agccgcctgatgggggcatttaacgtcagtaacttgctggtggcactggcaacactgctt
tcactgggttacccactaacacaattattagctgccgcacctcatctacaaccggtgtgt
gggcggatggaagtatttaatgcaccgggtaaaccgacggtagtggtggattatgcccac
acaccggatgcattggaaaaagcactggtggcggcacgtttacattgtaaaggccaactg
tggtgtgtgtttggttgcggtggtgatcgtgacaaaggtaagcgcccacttatgggcggt
atcgcggaacaactggctgatcgggtggttgtcactgatgataatccacgtagtgaagag
ccgcaggcgattgtcgccgatatcctcagtggattgctggatgccggacatgcgcaagcc
atccatggccgtgcagaagctgtgaccagcgccatcatgcaagctaaagccgatgatgtg
gtgttgattgccggcaaaggacatgaagattatcaattggtcggtaatcgccgcttggat
tactctgaccgagtcaccgtcgcgcgtttgttgggggggtggcatgattaa

DBGET integrated database retrieval system