KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_39311Help
Entry
Y11_39311         CDS       T02010                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00010  Glycolysis / Gluconeogenesis
yey00020  Citrate cycle (TCA cycle)
yey00620  Pyruvate metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01130  Biosynthesis of antibiotics
yey01200  Carbon metabolism
Module
yey_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y11_39311
   00020 Citrate cycle (TCA cycle)
    Y11_39311
   00620 Pyruvate metabolism
    Y11_39311
Enzymes [BR:yey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Y11_39311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: CBY28599
UniProt: A0A0H3NYB8
Position
4107555..4109417
Genome map
AA seq 620 aa AA seqDB search
MSIEIKVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDTVATGKLMMIFEATGAAAAPVKAEEKSAAPAPAAAPAASAVKNVEVPDIGGDEVEVT
EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMVFEVAG
AAAPAAATESAPAASAAKNVEVPDIGGDEVEVTEVMVKVGDKVAAEQSLITVEGDKASME
VPAPFAGIVKEIKINTGDKVKTGSLIMVFEVEGAVPAAASAPAPQAAAPASAAAPAAAPA
AKAENKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVKDAVKR
AEAAPAAATGGGLPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPHVTHFD
KTDITDLEAFRKLQNDEAAKRKLDVKFTPVVFIMKAVAAALEQMPRFNSSLSEDGQKLTL
KKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELMAISKKARDGKLTAGEMQGGCFTI
SSLGGIGTTHFAPIVNAPEVAILGVSKSAIEPVWNGKEFQPRLMMPMSLSFDHRVIDGAD
GARFITIINNMLADIRRLVM
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgaaatcaaagtaccggacatcggtgcagatgaagtggaagtcaccgaaatt
atggtgaaagtgggtgataccgttgaagctgagcaatcacttatcactgttgaaggtgat
aaagcttctatggaagtcccttcaccacaggcaggtgtcgttaaagaaatcaaaattgcg
gttggcgatactgttgcaaccggcaaactgatgatgatcttcgaagcaacaggtgccgct
gcggcacctgttaaagcggaagagaaatcagcggcccctgctccggcagcggctcctgca
gcatcggctgttaaaaatgttgaagtaccagatatcggcggtgatgaagttgaagtcact
gaagtgatggtcaaagtgggcgataaagttgccgctgaacaatctcttatcactgtagag
ggcgataaagcttctatggaagtgcctgcgccattcgccggtacggttaaagagatcaaa
atcaacactggcgataaagtcagcactggctctctgattatggtatttgaagtggcaggt
gctgcggcaccagctgcggcaactgagtcagcaccggctgcctctgctgccaaaaatgtt
gaagtaccagacattggtggtgatgaagttgaagtcacagaagtgatggtgaaagtgggc
gataaagttgccgctgaacaatcactgattaccgttgaaggtgataaagcttcgatggaa
gtcccggcaccattcgcgggcatcgtgaaagagatcaaaattaacaccggcgacaaagtg
aaaaccggttctctgatcatggtgtttgaagtggaaggcgcggtacctgcggccgcttcg
gctccagctccgcaagcagcagcacccgcttcagcggcggctcctgcagcagctccagcg
gcgaaagcagagaacaaaggcgagttcgctgagaatgatgcttacgtgcatgcaacgccg
gttatccgtcgtttggcccgtgaatttggcgtgaatctggcgaaagtgaaaggtacgggt
cgtaaaggccgtatcctgcgcgaagacgttcaggcttatgtgaaagatgcggtcaaacgt
gctgaagcggctcctgcggctgccaccggtggtggtctgccaggcatgctgccttggccg
aaagttgatttcagcaagttcggcgaaatcgaagaagtggaattgggtcgtatccagaaa
atctctggtgctaacttgagccgtaactgggtcatgattccacatgtaactcacttcgac
aaaaccgatatcaccgatctggaagcgttccgtaagctgcagaacgacgaagctgctaag
cgtaagctggacgtgaagttcaccccagtggtgttcatcatgaaagctgttgctgctgcc
ctcgagcagatgccacgtttcaacagctcactgtccgaagatggtcagaagctgacgctg
aaaaagtacatcaatatcggtgtcgcggtagatacgccaaatggtttggtcgttccggta
ttcaaggatgtgaacaagaaaagcatcactgaactgtcccgtgaactgatggctatctcc
aagaaagcgcgtgatggcaagctgaccgctggcgaaatgcagggcggttgcttcaccatc
tccagcctgggcggtatcgggacaactcacttcgcgccgattgttaacgcgccggaagtg
gctatcttgggtgtctccaagtctgcgatagagccagtctggaacggtaaagagttccag
ccgcgtctgatgatgccgatgtcgctctccttcgaccaccgtgtgatagacggtgctgat
ggtgcgcgctttatcactatcatcaacaatatgctggccgacattcgccgtctggtgatg
taa

DBGET integrated database retrieval system