KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_39311Help
Entry
Y11_39311         CDS       T02010                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:yey01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:yey00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:yey00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:yey00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4107555..4109417
Genome map
AA seq 620 aa AA seqDB search
MSIEIKVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDTVATGKLMMIFEATGAAAAPVKAEEKSAAPAPAAAPAASAVKNVEVPDIGGDEVEVT
EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMVFEVAG
AAAPAAATESAPAASAAKNVEVPDIGGDEVEVTEVMVKVGDKVAAEQSLITVEGDKASME
VPAPFAGIVKEIKINTGDKVKTGSLIMVFEVEGAVPAAASAPAPQAAAPASAAAPAAAPA
AKAENKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVKDAVKR
AEAAPAAATGGGLPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPHVTHFD
KTDITDLEAFRKLQNDEAAKRKLDVKFTPVVFIMKAVAAALEQMPRFNSSLSEDGQKLTL
KKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELMAISKKARDGKLTAGEMQGGCFTI
SSLGGIGTTHFAPIVNAPEVAILGVSKSAIEPVWNGKEFQPRLMMPMSLSFDHRVIDGAD
GARFITIINNMLADIRRLVM
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgaaatcaaagtaccggacatcggtgcagatgaagtggaagtcaccgaaatt
atggtgaaagtgggtgataccgttgaagctgagcaatcacttatcactgttgaaggtgat
aaagcttctatggaagtcccttcaccacaggcaggtgtcgttaaagaaatcaaaattgcg
gttggcgatactgttgcaaccggcaaactgatgatgatcttcgaagcaacaggtgccgct
gcggcacctgttaaagcggaagagaaatcagcggcccctgctccggcagcggctcctgca
gcatcggctgttaaaaatgttgaagtaccagatatcggcggtgatgaagttgaagtcact
gaagtgatggtcaaagtgggcgataaagttgccgctgaacaatctcttatcactgtagag
ggcgataaagcttctatggaagtgcctgcgccattcgccggtacggttaaagagatcaaa
atcaacactggcgataaagtcagcactggctctctgattatggtatttgaagtggcaggt
gctgcggcaccagctgcggcaactgagtcagcaccggctgcctctgctgccaaaaatgtt
gaagtaccagacattggtggtgatgaagttgaagtcacagaagtgatggtgaaagtgggc
gataaagttgccgctgaacaatcactgattaccgttgaaggtgataaagcttcgatggaa
gtcccggcaccattcgcgggcatcgtgaaagagatcaaaattaacaccggcgacaaagtg
aaaaccggttctctgatcatggtgtttgaagtggaaggcgcggtacctgcggccgcttcg
gctccagctccgcaagcagcagcacccgcttcagcggcggctcctgcagcagctccagcg
gcgaaagcagagaacaaaggcgagttcgctgagaatgatgcttacgtgcatgcaacgccg
gttatccgtcgtttggcccgtgaatttggcgtgaatctggcgaaagtgaaaggtacgggt
cgtaaaggccgtatcctgcgcgaagacgttcaggcttatgtgaaagatgcggtcaaacgt
gctgaagcggctcctgcggctgccaccggtggtggtctgccaggcatgctgccttggccg
aaagttgatttcagcaagttcggcgaaatcgaagaagtggaattgggtcgtatccagaaa
atctctggtgctaacttgagccgtaactgggtcatgattccacatgtaactcacttcgac
aaaaccgatatcaccgatctggaagcgttccgtaagctgcagaacgacgaagctgctaag
cgtaagctggacgtgaagttcaccccagtggtgttcatcatgaaagctgttgctgctgcc
ctcgagcagatgccacgtttcaacagctcactgtccgaagatggtcagaagctgacgctg
aaaaagtacatcaatatcggtgtcgcggtagatacgccaaatggtttggtcgttccggta
ttcaaggatgtgaacaagaaaagcatcactgaactgtcccgtgaactgatggctatctcc
aagaaagcgcgtgatggcaagctgaccgctggcgaaatgcagggcggttgcttcaccatc
tccagcctgggcggtatcgggacaactcacttcgcgccgattgttaacgcgccggaagtg
gctatcttgggtgtctccaagtctgcgatagagccagtctggaacggtaaagagttccag
ccgcgtctgatgatgccgatgtcgctctccttcgaccaccgtgtgatagacggtgctgat
ggtgcgcgctttatcactatcatcaacaatatgctggccgacattcgccgtctggtgatg
taa

DBGET integrated database retrieval system