KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_39311Help
Entry
Y11_39311         CDS       T02010                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Y11_39311
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y11_39311
   00020 Citrate cycle (TCA cycle)
    Y11_39311
   00620 Pyruvate metabolism
    Y11_39311
Enzymes [BR:yey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Y11_39311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4107555..4109417
Genome map
AA seq 620 aa AA seqDB search
MSIEIKVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDTVATGKLMMIFEATGAAAAPVKAEEKSAAPAPAAAPAASAVKNVEVPDIGGDEVEVT
EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMVFEVAG
AAAPAAATESAPAASAAKNVEVPDIGGDEVEVTEVMVKVGDKVAAEQSLITVEGDKASME
VPAPFAGIVKEIKINTGDKVKTGSLIMVFEVEGAVPAAASAPAPQAAAPASAAAPAAAPA
AKAENKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVKDAVKR
AEAAPAAATGGGLPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPHVTHFD
KTDITDLEAFRKLQNDEAAKRKLDVKFTPVVFIMKAVAAALEQMPRFNSSLSEDGQKLTL
KKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELMAISKKARDGKLTAGEMQGGCFTI
SSLGGIGTTHFAPIVNAPEVAILGVSKSAIEPVWNGKEFQPRLMMPMSLSFDHRVIDGAD
GARFITIINNMLADIRRLVM
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgaaatcaaagtaccggacatcggtgcagatgaagtggaagtcaccgaaatt
atggtgaaagtgggtgataccgttgaagctgagcaatcacttatcactgttgaaggtgat
aaagcttctatggaagtcccttcaccacaggcaggtgtcgttaaagaaatcaaaattgcg
gttggcgatactgttgcaaccggcaaactgatgatgatcttcgaagcaacaggtgccgct
gcggcacctgttaaagcggaagagaaatcagcggcccctgctccggcagcggctcctgca
gcatcggctgttaaaaatgttgaagtaccagatatcggcggtgatgaagttgaagtcact
gaagtgatggtcaaagtgggcgataaagttgccgctgaacaatctcttatcactgtagag
ggcgataaagcttctatggaagtgcctgcgccattcgccggtacggttaaagagatcaaa
atcaacactggcgataaagtcagcactggctctctgattatggtatttgaagtggcaggt
gctgcggcaccagctgcggcaactgagtcagcaccggctgcctctgctgccaaaaatgtt
gaagtaccagacattggtggtgatgaagttgaagtcacagaagtgatggtgaaagtgggc
gataaagttgccgctgaacaatcactgattaccgttgaaggtgataaagcttcgatggaa
gtcccggcaccattcgcgggcatcgtgaaagagatcaaaattaacaccggcgacaaagtg
aaaaccggttctctgatcatggtgtttgaagtggaaggcgcggtacctgcggccgcttcg
gctccagctccgcaagcagcagcacccgcttcagcggcggctcctgcagcagctccagcg
gcgaaagcagagaacaaaggcgagttcgctgagaatgatgcttacgtgcatgcaacgccg
gttatccgtcgtttggcccgtgaatttggcgtgaatctggcgaaagtgaaaggtacgggt
cgtaaaggccgtatcctgcgcgaagacgttcaggcttatgtgaaagatgcggtcaaacgt
gctgaagcggctcctgcggctgccaccggtggtggtctgccaggcatgctgccttggccg
aaagttgatttcagcaagttcggcgaaatcgaagaagtggaattgggtcgtatccagaaa
atctctggtgctaacttgagccgtaactgggtcatgattccacatgtaactcacttcgac
aaaaccgatatcaccgatctggaagcgttccgtaagctgcagaacgacgaagctgctaag
cgtaagctggacgtgaagttcaccccagtggtgttcatcatgaaagctgttgctgctgcc
ctcgagcagatgccacgtttcaacagctcactgtccgaagatggtcagaagctgacgctg
aaaaagtacatcaatatcggtgtcgcggtagatacgccaaatggtttggtcgttccggta
ttcaaggatgtgaacaagaaaagcatcactgaactgtcccgtgaactgatggctatctcc
aagaaagcgcgtgatggcaagctgaccgctggcgaaatgcagggcggttgcttcaccatc
tccagcctgggcggtatcgggacaactcacttcgcgccgattgttaacgcgccggaagtg
gctatcttgggtgtctccaagtctgcgatagagccagtctggaacggtaaagagttccag
ccgcgtctgatgatgccgatgtcgctctccttcgaccaccgtgtgatagacggtgctgat
ggtgcgcgctttatcactatcatcaacaatatgctggccgacattcgccgtctggtgatg
taa

DBGET integrated database retrieval system