KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_40081Help
Entry
Y11_40081         CDS       T02010                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4194427..4195143
Genome map
AA seq 238 aa AA seqDB search
MKKSLLLLPIVIAAFTGLAHADDAAIQQTLKKLDIQKADIQPSPIPGLSTVMTDSGVLYI
SADGKHLLQGPLYDVSGSQPVNVTNQMLVKKLEALSKEMIVYKAPQEKHVVTVFTDITCG
YCHKLHEQMSDYNALGITVRYLAFPRQGLSSQAEKDMRSIWCMADRNKAFDDAMKGVDIS
PATCKTDISEHYKLGVQFGIQGTPAIVLQNGTIVPGYLEPKEMLQMLNKHQASSKTAG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtttattactgctgccgatcgttatcgctgcattcacggggctggctcat
gctgatgatgccgctatccaacagacactgaaaaagttggatattcagaaagctgacatc
caaccatcacctatccccggcttgagtaccgtgatgactgacagcggtgtgctttatatt
tccgccgatggtaaacacttgttgcaagggccgctgtacgatgttagcggtagccaaccg
gtgaatgtaaccaaccagatgctggtgaaaaagttggaagcattgagcaaagaaatgatt
gtgtataaggcgccgcaagaaaaacacgttgttaccgtgtttactgatatcacctgcggc
tattgtcataaattgcacgaacaaatgagtgattataacgcgctggggattaccgtgcgt
tatctggccttcccacgtcaggggttgagctctcaggcagaaaaagacatgcgctcaatc
tggtgtatggctgatcgcaacaaagcattcgatgatgcgatgaaaggtgtcgatatatca
cctgcaacctgtaaaaccgatatttctgagcactataagttaggtgtgcagtttggtatt
cagggtactccagccatcgtgttgcaaaatggcactatcgttccaggttatctggagcca
aaagaaatgttacagatgctgaataagcaccaggcttcctcaaaaacggcgggttaa

DBGET integrated database retrieval system