KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_40771Help
Entry
Y11_40771         CDS       T02010                                 

Definition
(GenBank) exodeoxyribonuclease V alpha chain; RecD
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:yey00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Y11_40771
Enzymes [BR:yey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Y11_40771
DNA repair and recombination proteins [BR:yey03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Y11_40771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase AAA_22 DUF2075 PhoH AAA_16 UvrD_C CbiA AAA_28 T2SSE Herpes_Helicase FtsK_SpoIIIE MukB ArgK AAA SRP54 Flavi_DEAD NACHT TrwB_AAD_bind AAA_29 NTPase_1
Motif
Other DBs
NCBI-ProteinID: CBY28453
UniProt: A0A0H3NV65
Position
4262947..4264848
Genome map
AA seq 633 aa AA seqDB search
MMTLLEQAVRDHLLRPLDVQFSRMIAGDNDPMLQLAAAVLSAEAGAGHVCLPLSYLQPDQ
LFDGRQPALSQALWQAVGAPDQLHWTQKLNSSPAVSDGSQPTPLVLQNDRLYLQRMWQYE
GDVVRFIASDNMASLINETSDGSETRDVNETLLRDTLDRLFGPAENEVDWQKVAAAVAAT
RRISVISGGPGTGKTTTVAKLLTALIQLSQGQRLRIQLAAPTGKAAARLTESLGNAIRQL
SLTDDERKLFPDQASTLHRLLGAQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMARLI
AALPTKAQVIFLGDRDQLASVEAGAVLGDICRFAELGYSAPRAKQLARLTGCTLVGNIPI
GEVETDTVNVRDSLCLLRKSYRFDEKSGIGQLALAVNAGRYRDALAVFNGTYSDIERFSL
ADSDDYQVLLEDCAAGYQHYLELAAAGADAVDVLAAFGRYQLLCALRAGPFGVSGLNERI
EQLLHRKRLIERTPGPSGRWYVGRPAMIGLNDSALGLFNGDIGIALPDPEGELRVHFQLP
DGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFMPVLTRELVYTAITRARQ
RLTLYCNDKVLSRAIQTPTQRVSGLVDRLNQLT
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgttactggagcaagcggttcgtgaccacttactacggccactggatgttcag
ttctcgcggatgatagccggtgataatgatcccatgttgcaactggcagctgctgttctc
agtgctgaagctggtgctgggcacgtgtgtctaccattgagttatttgcagccagaccag
ctgtttgatggccgacagccagcgctatcacaagcactgtggcaggctgtcggtgcgcca
gatcaattacattggacacaaaaactcaatagctccccggcagtcagcgatggttcgcaa
cccacccccttagtgttgcaaaatgaccgtttgtatttacaacggatgtggcaatacgaa
ggtgatgtcgtgcgctttattgccagtgataatatggcgtcgcttatcaacgaaaccagt
gacggcagcgaaaccagagacgtcaacgaaacattattaagagatacgcttgatcgccta
tttgggccggcagaaaatgaggttgactggcaaaaagtcgccgcggcggtagcggctacc
cgccgtatttccgtgatttccggtggtccagggacggggaaaacaacgacggtagccaag
ttattgaccgcattgatacaactgagccaagggcaacgtttacgtatccaacttgccgct
ccaaccggtaaagctgccgcacggttaactgaatcgctggggaacgccattcgccagctc
tcactaactgacgatgaacgcaagctattcccagatcaagcatccacattgcaccgttta
ttgggtgcacaacctaacagccagcgcttacggtaccatcgtggtaaccctctaaatctt
gatgtgctggtggttgatgaagcatcaatggtggatttgcccatgatggcgcggctcatt
gcagcattacccactaaagctcaggttatttttctcggtgaccgtgaccaattggcttcg
gtagaggcgggagctgtactgggtgatatatgtcgttttgctgagttgggttacagcgcg
cctagagctaaacagttagctcgcttaacgggatgcacattagtaggaaatatcccgatt
ggtgaggtggagacagataccgtcaatgtccgagatagtttgtgtttgctgcgcaaaagt
taccgcttcgatgaaaaatccggtatcgggcaacttgctttagcggttaatgccgggaga
tatcgtgatgcgttagccgtttttaacggtacatattcggatatcgagcgcttttctctg
gcagattccgatgattaccaggtattgctggaggactgtgctgctggttatcagcactat
cttgaactggcagccgcaggtgctgatgcggtggatgtacttgctgcatttggccgctat
caactgttatgcgcattacgcgccgggccatttggtgtcagtggcttaaacgagcggatc
gaacaactattgcatcgcaagcgattaatagagcgaacgccagggccatcgggccgttgg
tatgttggcaggccggcgatgataggattgaatgacagtgcgctgggtttattcaacggc
gatattggtattgctttacctgatcctgaaggtgagttgcgggtgcatttccaattaccg
gacggcaatatcaaatcggtgcagccgagtcgtcttcccagccatgaaactgcttatgct
atgaccgtacataaatctcaagggtcggagtttgagcatactgcattggttctacccaat
acttttatgccggtgttaacccgcgaattggtctataccgccattacccgtgcccgtcag
cgtttgacattgtattgcaatgataaggtattgagccgagctatccagacacccacacag
cgtgttagcggattagtagaccgtttgaatcaattgacttga

DBGET integrated database retrieval system