KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_40771Help
Entry
Y11_40771         CDS       T02010                                 

Definition
exodeoxyribonuclease V alpha chain; RecD (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:yey03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4262947..4264848
Genome map
AA seq 633 aa AA seqDB search
MMTLLEQAVRDHLLRPLDVQFSRMIAGDNDPMLQLAAAVLSAEAGAGHVCLPLSYLQPDQ
LFDGRQPALSQALWQAVGAPDQLHWTQKLNSSPAVSDGSQPTPLVLQNDRLYLQRMWQYE
GDVVRFIASDNMASLINETSDGSETRDVNETLLRDTLDRLFGPAENEVDWQKVAAAVAAT
RRISVISGGPGTGKTTTVAKLLTALIQLSQGQRLRIQLAAPTGKAAARLTESLGNAIRQL
SLTDDERKLFPDQASTLHRLLGAQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMARLI
AALPTKAQVIFLGDRDQLASVEAGAVLGDICRFAELGYSAPRAKQLARLTGCTLVGNIPI
GEVETDTVNVRDSLCLLRKSYRFDEKSGIGQLALAVNAGRYRDALAVFNGTYSDIERFSL
ADSDDYQVLLEDCAAGYQHYLELAAAGADAVDVLAAFGRYQLLCALRAGPFGVSGLNERI
EQLLHRKRLIERTPGPSGRWYVGRPAMIGLNDSALGLFNGDIGIALPDPEGELRVHFQLP
DGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFMPVLTRELVYTAITRARQ
RLTLYCNDKVLSRAIQTPTQRVSGLVDRLNQLT
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgttactggagcaagcggttcgtgaccacttactacggccactggatgttcag
ttctcgcggatgatagccggtgataatgatcccatgttgcaactggcagctgctgttctc
agtgctgaagctggtgctgggcacgtgtgtctaccattgagttatttgcagccagaccag
ctgtttgatggccgacagccagcgctatcacaagcactgtggcaggctgtcggtgcgcca
gatcaattacattggacacaaaaactcaatagctccccggcagtcagcgatggttcgcaa
cccacccccttagtgttgcaaaatgaccgtttgtatttacaacggatgtggcaatacgaa
ggtgatgtcgtgcgctttattgccagtgataatatggcgtcgcttatcaacgaaaccagt
gacggcagcgaaaccagagacgtcaacgaaacattattaagagatacgcttgatcgccta
tttgggccggcagaaaatgaggttgactggcaaaaagtcgccgcggcggtagcggctacc
cgccgtatttccgtgatttccggtggtccagggacggggaaaacaacgacggtagccaag
ttattgaccgcattgatacaactgagccaagggcaacgtttacgtatccaacttgccgct
ccaaccggtaaagctgccgcacggttaactgaatcgctggggaacgccattcgccagctc
tcactaactgacgatgaacgcaagctattcccagatcaagcatccacattgcaccgttta
ttgggtgcacaacctaacagccagcgcttacggtaccatcgtggtaaccctctaaatctt
gatgtgctggtggttgatgaagcatcaatggtggatttgcccatgatggcgcggctcatt
gcagcattacccactaaagctcaggttatttttctcggtgaccgtgaccaattggcttcg
gtagaggcgggagctgtactgggtgatatatgtcgttttgctgagttgggttacagcgcg
cctagagctaaacagttagctcgcttaacgggatgcacattagtaggaaatatcccgatt
ggtgaggtggagacagataccgtcaatgtccgagatagtttgtgtttgctgcgcaaaagt
taccgcttcgatgaaaaatccggtatcgggcaacttgctttagcggttaatgccgggaga
tatcgtgatgcgttagccgtttttaacggtacatattcggatatcgagcgcttttctctg
gcagattccgatgattaccaggtattgctggaggactgtgctgctggttatcagcactat
cttgaactggcagccgcaggtgctgatgcggtggatgtacttgctgcatttggccgctat
caactgttatgcgcattacgcgccgggccatttggtgtcagtggcttaaacgagcggatc
gaacaactattgcatcgcaagcgattaatagagcgaacgccagggccatcgggccgttgg
tatgttggcaggccggcgatgataggattgaatgacagtgcgctgggtttattcaacggc
gatattggtattgctttacctgatcctgaaggtgagttgcgggtgcatttccaattaccg
gacggcaatatcaaatcggtgcagccgagtcgtcttcccagccatgaaactgcttatgct
atgaccgtacataaatctcaagggtcggagtttgagcatactgcattggttctacccaat
acttttatgccggtgttaacccgcgaattggtctataccgccattacccgtgcccgtcag
cgtttgacattgtattgcaatgataaggtattgagccgagctatccagacacccacacag
cgtgttagcggattagtagaccgtttgaatcaattgacttga

DBGET integrated database retrieval system