KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_41061Help
Entry
Y11_41061         CDS       T02010                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00900  Terpenoid backbone biosynthesis
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Y11_41061
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Y11_41061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: CBY28424
UniProt: A0A0H3NT93
Position
4295583..4296779
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGNSTLGVVRANPELFKITALVAGRNVHQMAQQCLEFAPRYAAMSDET
SAKALRLILAENGSRTEVYSGEKAACELAATGDVDQVMAAIVGVAGLPSTLAAIRAGKQV
LLANKESLITCGKLFMDEVKHSRAQLLPIDSEHNAIFQSLPEKVQSQLGYSSLSDNGVFR
IILTGSGGPLRETPLVQFADVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAKQVEVILHPQSVIHSMVRYHDGSVLAQMGTPDMRTPIAHAMAYPMRVNSGVAPLDFC
KIRELTFAEPDYQRYPCLKLAIDASNAGQAATTALNAANEISVMAFLDSRIRFTDIAVIN
RIVVEQLSLPEPASVDEVLVIDRKARDVAVQAIAKLNN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactgactattcttggttctacaggctccatcggcaacagcacactgggtgtt
gtgcgcgctaatcccgaattattcaaaatcaccgcattggttgctggtcgcaatgtccac
cagatggcgcaacaatgtctcgaatttgccccccgttatgcagctatgtccgatgaaacc
tcggctaaagcgttacgcctgatattggcagaaaatggttcacgaactgaggtttattcc
ggtgagaaagcggcgtgtgaactggcggcgacaggcgatgtcgatcaggtaatggctgct
attgtcggcgtcgcagggttgccttccacgctggcggctatccgtgcgggtaaacaagta
ttactggctaacaaagagtcgctgattacctgtggtaagctttttatggatgaagtgaag
cacagtcgtgcgcaattgctacccatcgacagcgaacataatgctatttttcagagtttg
cctgaaaaggttcagtctcaattaggctattcttcactgagtgataatggtgttttccgc
attattttaaccggctctggtggcccactgcgcgaaacgccattagtgcaattcgcagat
gtcactccagaccaggcttgcgcgcatccaaactggtctatggggcgtaagatttcggtc
gactctgcgacaatgatgaacaaagggctagagtatatcgaggcgcgctggttatttaac
gctagcgcaaaacaagtggaggttattttacatcctcaatctgtcattcattcgatggtg
cgctaccatgatggcagtgtattggcgcagatgggtaccccagatatgcggacacctatt
gcgcatgcgatggcatacccaatgcgcgtgaattcaggcgttgcgccgctggatttctgc
aaaatacgcgagctgacttttgctgagccggattatcaacgttatccctgcctgaagctg
gctattgatgcttctaatgcaggtcaggccgcaaccacagcactgaatgccgccaatgaa
atttctgtcatggcatttttagattcgagaattcgtttcaccgacattgcagtcattaat
cgtattgtagtggagcagttatcattaccagagccagccagtgtagatgaggtattggtg
attgaccgtaaagcccgtgatgtagccgttcaagcaatagcaaaattgaataattaa

DBGET integrated database retrieval system