KEGG   Yarrowia lipolytica: YALI0A03861gHelp
Entry
YALI0A03861g      CDS       T01033                                 

Definition
YALI0A03861p
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     YALI0A03861g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:complement(418341..420242)
Genome map
AA seq 633 aa AA seqDB search
MSVTWEATPTSFNLTIKYNRPIKRQVGRPRKTVTGVPQPIIEPRRRNRPKSSPRKCTPPA
ASASPRRSPVKLRIPVPRRNSNSSDSYSTDSGDDSDDYGLRVRVRRPRNTRETRSRSAQI
RDRGRERERRATSNVPRLIESPDSSTSPGPSPRRSPSPINSDYSSSPSTPIETEPPYRGA
LVGEDASTAETNPNADDIALFSKTLSLAESKRSSRGDASLGTTKNANITCIHFGDYEINT
WHTAPYPEEYARNKVLPLCEFCLKYMSSGHVRKRHKLKCAARHPPGTEIYRHGNISIWEV
DGARAQLYCQNLCLLAKMFLNSKTLYYDVEPFMFYVLTENDAFGCHFVGYFSKEKQQPYK
TTGTNNVSCILTLPIFQRKGYGQLLIDFSYLLSRVEGRPGTPEKPLSDLGLLSYRKYWRL
MICRFFFNAREKAADKKTIPNFSVMDITKSTGMTPDDVISALESLEFLVRNPETGKYAIR
LNWEAIDMVVNKYKANNYVQLEPSKLIWAPVPEWPFTKVPTREDLEPGMRIVEVDDKDGD
GVEEEEQKLEGDKKDDDSESDAGADDVDSEAESTTDYSKFETAYPIPRMTTTVEKAAPQR
TTKSRSRRRDRRYQGGVRRPRGRPRKYPLVTKA
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgacgtgggaagcgacgccaacgtcgttcaacttgactatcaagtacaaccgg
cctatcaagcggcaggtcgggcggccgcgcaaaactgtcacgggtgttcctcagcccatc
atcgagccccgaagacgcaaccgccccaaaagcagcccccgaaaatgcactcctccagcg
gcatcggcgtctccgagacgcagcccggtcaagctgcgcatcccagtgcccagacgcaac
tccaactccagcgacagctacagcaccgacagtggcgacgacagtgacgactatggtctg
agagtgagggtgcgacggccgcgaaacacgcgcgaaacccggtctagaagcgcgcagatc
cgagacagaggccgtgaacgcgaacgacgcgccacaagcaacgtcccccggttaatcgag
tcgcccgattcgtccacgtctcccggtccatcgccacgacgatcgccatcgcccatcaac
tcggactactcctcatcgcctagcacaccgattgaaacggagcctccctacagaggagct
ctagtgggcgaggacgcatcgacagcagaaaccaaccccaacgccgacgacattgcactc
ttctcaaagactctcagcctggccgagtccaaacggtcttcccgaggagatgcgtcgctg
ggaaccaccaagaacgccaacattacatgcatccactttggcgactacgaaatcaacact
tggcatacagcgccatacccagaagaatacgcccgaaacaaggtgctaccgctgtgcgag
ttctgtctcaagtacatgtcttccggacacgtgcgcaaacgccacaaactaaagtgtgca
gcccgtcaccctcccggaacagaaatatatcgccacggcaacatttccatctgggaagtt
gatggtgcgcgtgcccagctatactgtcagaacctgtgtctgttggccaaaatgtttctc
aactcgaaaacgctttactacgacgtggagcccttcatgttctacgttctgaccgaaaat
gacgcgttcggatgccatttcgtcggctatttctccaaggaaaaacaacaaccctacaaa
accacaggcaccaacaacgtgtcctgcattttgactctccccattttccaacgaaaggga
tacggacagctgctgattgacttttcgtacctgctgagtcgagtcgaaggtcgcccaggc
acgcctgaaaaacccctcagtgacctgggcttgctgagctacagaaagtactggcggctg
atgatctgccggttctttttcaatgctcgcgaaaaggcggccgacaagaaaaccatccca
aacttctccgtcatggacatcaccaaatccaccggcatgacacctgacgacgtcatttct
gctcttgagtcactcgaatttctggtcagaaaccctgagacaggcaagtatgccattcgc
ttgaattgggaggccatcgatatggtcgtcaacaagtacaaggcaaacaactatgtgcag
ttggagccatcaaagctgatttgggctccggtgccggagtggccgttcacaaaggttcct
actagagaggacttggagcctggaatgaggatcgtcgaagtggatgacaaggacggtgat
ggggtcgaagaggaggagcagaaactcgaaggggacaagaaggatgatgacagcgagagt
gatgctggcgctgacgatgtcgattccgaggctgagtccacaacagactactccaagttt
gagacagcctaccccattcctcgaatgaccaccacagtggagaaagccgctccccaaaga
accacgaaatcaaggtccagacgtcgagaccggcgataccagggcggcgttagacgtcct
cgaggtcggcctagaaagtatcctctggttacaaaggcctga

DBGET integrated database retrieval system