KEGG   Yarrowia lipolytica: YALI0A06996gHelp
Entry
YALI0A06996g      CDS       T01033                                 

Definition
YALI0A06996p
Orthology
K06634  
cyclin H
Organism
yli  Yarrowia lipolytica
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    YALI0A06996g
  Replication and repair
   03420 Nucleotide excision repair
    YALI0A06996g
Transcription machinery [BR:yli03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YALI0A06996g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:complement(678527..679621)
Genome map
AA seq 364 aa AA seqDB search
MTSATASSKATKTVTDDDIYRQSSQFKKWSFTPTQLAARRLQTNTNGREFVKQSFLAADL
DPAMAKILSVDEELTMVNYMCSQSEGIAQVLNLPSKVKATAVLFFKKFFLINSVMVYSDP
VKVLHTCFFLATKAENHFFSINQFCKYTGAVAKDVLQLEFVVMQSMLFSLSAQSAYTPLH
GFYLDIQTSLPHVPASTVGSLYDGARKYVSLSFLTDANFLFTPPQISLAAMMCTNSQITE
QYLRVKMSDPAQFNLTTKLVQECVDMLQKVDKPTKEYVQEIGKKLRSCDVEKTKARLLKR
KLKEQGEGDAKKQKLDSETPQPPDMSNSASTEPASAEASASASASTTDASAPASASASAS
TEQS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgctacagcatcatccaaggccacaaaaacggtcacggacgacgatatttac
cggcaatcgtcgcagttcaaaaaatggtcgtttacgccgacgcaactggcagctagacgg
cttcaaaccaacaccaacggccgcgagtttgtcaaacagtcgtttctagcggcggatctc
gatcccgccatggccaaaatcctctctgttgacgaggaacttaccatggtcaattacatg
tgttctcagagcgagggaattgcccaagttctcaatctaccttctaaagtgaaggcaaca
gctgtactcttcttcaaaaagtttttcctcatcaactccgtcatggtgtacagtgacccc
gtcaaggtcttgcatacgtgtttctttttggccaccaaagccgagaatcacttcttttcc
atcaaccagttctgcaaatacactggagcggtggccaaggacgttttgcaactcgagttt
gtggtgatgcagtcgatgctgttttctttgagcgcccagagcgcatacactcccttgcat
ggcttctatctcgacatccagacgtcgctgccccacgttcctgcctcgacagtcgggtct
ctgtacgatggagccagaaagtacgtgtctctgagctttctaaccgacgcaaatttcctc
tttacccctccgcaaatctcgctcgcggccatgatgtgcacaaatagccagataaccgag
cagtatttgcgagtgaagatgagcgacccagcgcagttcaacctgaccacaaagctggtt
caggagtgcgttgacatgctgcaaaaggtggacaagccgaccaaggagtatgtgcaggag
attggaaagaagctgcggtcgtgtgacgtggagaaaaccaaggcgagattgctgaaacgc
aagcttaaggagcagggagagggcgacgcaaagaagcagaagctggactcggaaactcct
cagcctccagacatgtccaattccgcttctactgagcctgcatccgcagaggcttctgct
tcggcgtctgcatcgacaacagatgcttctgctccggcgtcggcgtctgcgtctgcgtcc
actgaacagtcctaa

DBGET integrated database retrieval system