KEGG   Yarrowia lipolytica: YALI0A10310gHelp
Entry
YALI0A10310g      CDS       T01033                                 

Definition
YALI0A10310p
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
yli  Yarrowia lipolytica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:yli00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:complement(1048091..1048996)
Genome map
AA seq 301 aa AA seqDB search
MSGFDDDERINAFEKRHDSTNTIRPEVNGRVPAPHQPQPQHPTVNTSLPSTRSSSVSSSR
SKLSQYSYLGQQEGTPLNTRVASPYTLNPPIDFDGLSWPSVGARARLEQTEEEAKAREGR
IADAVKTILTELGEDPNREGLLETPERYARAMLFFTKGYEDNVKDVIKRAVFEEDHDEMV
IVRDIEIFSLCEHHLVPFFGKIHIGYIPNSRVLGLSKLARLAEMFSRRLQVQERLTKQVA
MALWEILEPQGVAVVIEASHMCMVSRGVQKSGSSTLTSCMLGRFRDAQKTRDEFLTLIGK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggtttgacgacgacgaacgaatcaatgcattcgaaaaacgacatgattcgacc
aacacgattcgaccagaggtgaacggacgagttcccgcaccgcaccagcctcagccccaa
caccccaccgtcaacacctccctgccttctactcgatctagctccgtttcatcgtctcga
tccaagctgtcgcaatactcttaccttggacaacaggagggtactcctctcaacacccga
gtggcgagcccatacacgctcaacccccccatagatttcgacggcctgtcgtggccttct
gtcggtgctagagctcgtcttgagcagactgaggaggaggccaaagcccgtgaaggacgt
attgcagatgcagtcaagacgattttgacagagctgggagaagacccaaaccgtgaaggt
ctcttggagacgcccgagagatacgcccgagccatgctgtttttcacaaagggctacgaa
gacaacgtcaaggatgttatcaagcgggctgtttttgaagaggatcatgacgaaatggtc
attgttcgagatatcgaaatcttctcgttgtgtgagcaccatcttgtgccctttttcggc
aagattcacattggctacatccccaactcgcgagttttgggtctcagtaagcttgcccgt
ctcgcagagatgttctctcggcgactgcaagttcaggagcgactcaccaagcaggtggct
atggccttgtgggagattctggagccccagggagtggcagtggtgattgaagcctcccac
atgtgtatggtatcccgaggcgtgcaaaagagcggtagtagcacgctcaccagttgcatg
cttggccgcttcagagacgcccagaagactcgagacgaatttttgacactcattggaaaa
agatag

DBGET integrated database retrieval system