KEGG   Yarrowia lipolytica: YALI0A13387gHelp
Entry
YALI0A13387g      CDS       T01033                                 

Definition
YALI0A13387p
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
yli  Yarrowia lipolytica
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YALI0A13387g
Enzymes [BR:yli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     YALI0A13387g
Peptidases [BR:yli01002]
 Cysteine Peptidases
  Family C44
   YALI0A13387g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:1381245..1382939
Genome map
AA seq 564 aa AA seqDB search
MCGIFAAYKLPDVAEYKTHALQLSKRIRHRGPDWSGNCSKNNTIICHERLAIVGLDTGAQ
PITSPDESIVLGVNGEIYNHRILRKEFPDYKFKTHSDCEPIIPLYEKYGIDAPKKLDGMF
AFVLYDSNKDRIIAARDPIGITTLYMGRSYKNPQTVWFASELKCLVDDCDEIKAFPPGHV
YDSDTDKITRYFEPSWWDGSKIPTKRVDYKELREALEAAVRKRLMSEVPYGVLLSGGLDS
SLIASIAARETRRAAPEKTVNQDLAGVDEQGHLTNSSGSRLHSFSVGLPGAPDLLAAQKC
AEFIGTIHHEYTFTVQEGLDALRDVIYHLETFDVTTIRASTPMYLLSRKIKAGGVKMVLS
GEGSDEVFGGYLYFGAAPSPEAFHTECVQRVKNLHYADCLRANKSTMAWGLEARVPFLDK
QFLEVAMNIDPKDKIIDKDHIEKYSIRKAFDTSDEPGAEPYLPDEILWRQKEQFSDGVGY
SWIDGLKDAAENTITDEQLKNPKPHWGADVPKTKEAYWYRCMFDELFPQPAAATTVMRWI
PKADWGCAEDPSGRYVKSHSAHKQ
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattttcgccgcctacaaactgcccgacgtggccgagtacaagacacatgcg
ctgcagctgtccaagcgaatccgacaccggggccccgactggtcgggaaactgctccaag
aacaacaccatcatttgccacgagcgactggccattgtgggtctggacaccggagcccag
cccatcacctcgcctgacgagtcgattgttctgggagtgaacggagagatctacaaccac
cgaatcctgcgaaaggagttccccgactacaagttcaagacccactcggactgtgagccc
atcattcctctgtacgagaagtacggcatcgacgcccccaagaagctcgacggaatgttt
gcctttgttctgtacgactccaacaaggaccgaattatcgccgcccgagaccccattgga
atcaccaccctgtacatgggccgatcttacaagaacccccagactgtgtggtttgccagc
gagctcaagtgtctggtggacgactgtgacgagatcaaggccttcccccccggccacgtc
tacgactccgacaccgacaagatcacccgatactttgagccctcctggtgggacggatcc
aagatccccaccaagcgagttgactacaaggagctccgagaggctctggaggctgctgtt
cgaaagcgactcatgtccgaggttccctacggtgttctgctttccggcggtctcgattct
tctctgattgcctccatcgctgcccgagagacccgacgagctgctcccgagaagaccgtc
aaccaggatcttgccggtgtcgacgagcagggccacctgaccaactcttccggctcgcga
ctgcactccttctccgtcggtctgcccggcgctcccgatctgcttgccgcccagaagtgt
gccgagttcattggcaccatccatcacgagtacaccttcactgtccaggagggtctggac
gctcttcgagacgtcatctatcacctggagacctttgacgtgaccaccatccgagcctcc
acccccatgtacctgctttctcgaaagatcaaggccggaggagtcaagatggttctgtcc
ggtgagggatccgatgaggtctttggcggctacttgtactttggcgctgctccctctccc
gaggccttccacaccgagtgtgtgcagcgagtcaagaacctgcactacgccgactgtctg
cgagccaacaagtccaccatggcctggggactggaggcccgagtgcccttcctggacaag
cagttcctggaggttgccatgaacattgatcctaaggacaagatcatcgacaaggaccac
attgagaagtactccatccgaaaggcctttgatacctccgacgagcccggcgctgagccc
tacctgcccgacgagattctgtggcgacagaaggagcagttttccgacggagttggctac
tcgtggatcgacggtctcaaggatgccgccgagaacaccatcaccgacgagcagctcaag
aaccccaagcctcactggggtgctgacgttcccaagaccaaggaggcctactggtaccga
tgcatgttcgacgagctgttcccccagcccgccgccgccaccaccgtcatgcgatggatc
cccaaggccgactggggatgtgccgaggatccttccggacgatacgtcaagtctcactct
gctcataagcagtag

DBGET integrated database retrieval system