KEGG   Yarrowia lipolytica: YALI0A14498gHelp
Entry
YALI0A14498g      CDS       T01033                                 

Definition
YALI0A14498p
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
yli  Yarrowia lipolytica
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YALI0A14498g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     YALI0A14498g
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     YALI0A14498g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:1464698..1465219
Genome map
AA seq 173 aa AA seqDB search
MKFYYHDNDSSVDQCAPHDSGEPVTAEQLEKIGVLAFHYPDVEDVNRLAKERKYTNRDEV
TITPEAMGGQENYEKKLKVFYEEHLHEDEEIRYILDGEGYFDVRDKDDRWIRAQLNAGDL
LILPSGIYHRFTLSEKNYVHTMRLFQAEPKWVALPRPVDNNPYRQEYVKAISA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctactaccacgacaacgactccagcgtcgaccagtgtgcgccccacgactcg
ggcgagcccgtgacggcggagcagctggagaaaatcggcgttctggcgttccactacccc
gatgttgaggacgtgaaccgtctggccaaggagcgaaagtacacaaaccgagacgaggtg
accatcactccagaggcgatgggcggccaggaaaactacgagaagaagctcaaggtcttc
tacgaggagcatctgcacgaggacgaggagattcggtacattttggacggcgagggatac
tttgacgttcgagacaaggacgaccgatggattcgggcccagctcaatgccggcgacctg
ctgattctgcccagcggcatctaccatcggttcactttgtctgagaagaactatgtccac
accatgcgattgtttcaggccgagcccaagtgggtcgctttgccccgacctgtggacaac
aatccttatcgacaggagtacgtcaaggccatttctgcttag

DBGET integrated database retrieval system