KEGG   Yarrowia lipolytica: YALI0A15950gHelp
Entry
YALI0A15950g      CDS       T01033                                 

Definition
YALI0A15950p
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
yli  Yarrowia lipolytica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:yli01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:yli00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:1626119..1628686
Genome map
AA seq 855 aa AA seqDB search
MFPLLPQVSSVTVPAVAVAPGKVLVSILQSDVPEIAKELKKAFGQAQFHIMADTDLSTDE
YIHLLDAGASSVFVSGESAVDLAASGVPAGRLTVIGSKPDNLDVGGVFLKDTPALEDVAT
LASTFAKQLLPSGGAPVVYVNVEDPKAAADLAATGATVVVSSAKLTTEHQADKLDDKFPI
ADLLLASLSTDRQDGLYTTLVTDVLNQSLGLVYSSAESIKEAIRTGTGVYQSRRHGLWYK
GKESGNTQKLIRIETDCDGDCLKFIVEQTGAGFCHFNTESCFSAAQGISCLEKTLQQRLQ
NAPAGSYTKRLFDDSDLLRAKIMEEAEELVEAKDAEEVSWEAADLIYFAMVKVVKEGVSW
AQVMNNLDSKHMKISRRKGDAKQKWVDALGIKRQKVDEKPKEEKKEEKKEEIKEDGKIQL
NHINADTASKAEIETVLARPAQKTSDIMKLVLPIVEGVKTGGDKKLLELTEKFDGVKLES
PILTAPFSEDLMKISDDVKASIDMSIANVKKFHAAQLDTTELVVETQPGVVCKRFSRPIE
SVGLYIPGGTAVLPSTSLHLGVPAMVAGCKNIVLASPPRKDGTLSPEVVYVAHQIGAKAV
VLAGGAQAVAAMAYGTESVPKVDKIMGPGNQFVTAAKMYVSNDTTAKVAIDMPAGPSEVL
VICDKHANPAFVASDLLSQAEHGVDSQVILLAVDCDQKHLDAIDEELHAQALALPRVDII
RKCIAHSSALSVKTMDEAFKLSNQYAPEHLILQIEDADKYVPLVDHAGSIFVGAYSPESC
GDYSSGTNHTLPTYGYARMYSGVNTGTFTKHITSQQLTREGLEIIGPAVMTLAATEGLDA
HRMAVKVRLDAMKKE
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgttccccctgctgccccaagtgagcagcgtgactgttccggctgtggctgtggcgccc
ggcaaggtgctggtgtccattctccagtccgacgtccccgagatcgccaaggagctcaaa
aaggcgtttggacaggcccaatttcacatcatggccgacacagacctgtcgaccgacgag
tacatccacctgctggacgccggcgcctcgtctgtgtttgtgtctggagagtccgctgtt
gatctggctgcctccggcgtgcctgctggccgtctgacagtgattggctccaagcccgac
aacctggacgtcggcggcgtcttcctcaaggacacccccgctctggaggatgtggcgacg
ctggcctcgaccttcgccaagcagctgctgccctcgggaggagccccggttgtgtacgtc
aacgtggaggatcccaaggccgcggctgatctggctgcaaccggcgccactgtggtggtg
agctccgctaagctgaccaccgaacaccaggccgacaagctggacgacaagttccccatt
gccgatctgctgttggcgtctctgtccaccgaccgacaggacggcctgtacactactctg
gtgaccgatgtgctcaaccagtcgctcggcctcgtctactcgtcggctgagtccatcaag
gaggccattcgaaccggcactggtgtttatcagtcccgacgacacggtctgtggtacaag
ggtaaggagtctggaaacacccagaagctgatccgaattgagactgactgcgatggagac
tgtctcaagttcatcgttgagcagaccggcgcgggcttctgccacttcaacaccgagagc
tgtttctccgctgcccagggcatttcttgtctggagaagacccttcagcagcggctgcaa
aatgcccccgcaggttcgtacacaaagcgactttttgacgactcggatctgctgcgagcc
aagatcatggaggaggctgaggagctcgtggaggccaaggacgccgaggaggtgtcttgg
gaggctgccgacctcatctactttgccatggtcaaggttgtcaaggaaggcgtgagctgg
gcccaggtgatgaacaacctcgacagcaagcatatgaagatttcgcgacgaaagggcgac
gccaagcaaaagtgggtcgacgctctgggcatcaagcgacagaaggtggacgagaagccc
aaggaggagaagaaggaagagaagaaggaggagatcaaggaggacggaaagatccagctc
aaccacatcaatgctgataccgcctccaaggccgagattgagactgttctggcccgacct
gctcagaagacctctgatatcatgaagcttgtgcttcccattgttgagggagtcaagact
ggaggcgacaagaagctgctggagctgaccgagaagtttgacggtgtcaagctcgagtct
cctattctcactgctcctttctccgaggacctgatgaagatttccgatgatgttaaggct
tccattgacatgtccattgcgaacgtcaagaagttccacgctgcccagcttgacaccacc
gagcttgtggttgagacccagcccggtgtggtctgcaagcgattttctcgacccattgag
agtgtcggtctgtacattcctggtggaactgcagttcttccttccacctctctgcatctc
ggtgtccctgccatggttgctggatgcaagaatattgttctggcctcccctccccgaaaa
gacggcactctttcccccgaggttgtctacgttgctcaccagattggcgccaaggccgtt
gttcttgctggaggcgcccaggccgtcgctgctatggcttacggaaccgagtccgtgccc
aaggttgacaagatcatgggtcctggaaaccagtttgtcaccgccgccaagatgtacgtg
tccaacgacaccactgccaaggtggctatcgacatgcccgccggcccctctgaggtgctt
gtgatctgcgacaagcacgccaaccctgcctttgttgcctccgatctgctttctcaggcc
gagcacggcgttgattcccaggtcattctgctggctgtggactgcgaccagaagcacctt
gatgccattgatgaggagctgcatgctcaggctcttgctcttcctcgagtcgacattatc
cgaaagtgtattgcccactcttctgctcttagcgtcaagaccatggacgaggccttcaag
ctgtccaaccagtacgcccccgagcatctgattctgcagattgaggatgccgacaagtac
gtgcctctggtggaccacgctggttccattttcgtcggagcttactctcccgagtcttgt
ggagactactcttccggaaccaaccacactctgcccacctacggatacgcccgaatgtac
tctggcgtgaacaccggcaccttcaccaagcacattacgtcgcagcagctgacccgggag
ggtctggagatcattggtcccgccgttatgacacttgctgccaccgagggtctggacgcc
caccgaatggccgtcaaggtccgactcgacgccatgaagaaggaataa

DBGET integrated database retrieval system