KEGG   Yarrowia lipolytica: YALI0A16379gHelp
Entry
YALI0A16379g      CDS       T01033                                 

Definition
(RefSeq) YALI0A16379p
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli00010  Glycolysis / Gluconeogenesis
yli00071  Fatty acid degradation
yli00350  Tyrosine metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YALI0A16379g
  Lipid metabolism
   00071 Fatty acid degradation
    YALI0A16379g
  Amino acid metabolism
   00350 Tyrosine metabolism
    YALI0A16379g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YALI0A16379g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 adh_short Epimerase AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 2906568
NCBI-ProteinID: XP_500127
UniProt: Q6CGT5
Position
A:1675359..1676408
Genome map
AA seq 349 aa AA seqDB search
MTTIPKTQKAVIFETSGGPLMYKDVPVPVPADDEILVNVKYSGVCHTDLHAWKGDWPLDT
KLPLIGGHEGAGVVVAKGKNVTTFEIGDYAGIKWINKACYTCEFCQVAAEPNCPKATMSG
YTHDGSFQQYATANAVQAAHIPKNCDLAQVAPILCAGITVYKALKTAGLKAGEWAAVTGA
GGGLGSLAVQYAKAMGYRVLAIDTGADKEKMCKELGAEVFIDFAKSKDLVKDVQEATKGG
PHAVINVSVSEFAVNQSVEYVRTLGTVVLVGLPAGAVCKSPIFQQVARSIQIKGSYVGNR
ADSQEAIEFFARGLVKSPIIIVGLSELESVYKLMEEGKIAGRYVLDCSK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatccccaagacccagaaagccgtcatcttcgagacctccggcggccccctc
atgtacaaggacgtgcctgtgcccgtgcctgccgacgacgagattctggtcaacgtcaag
tactccggcgtgtgccacacggacctgcacgcctggaagggcgactggcccctggacacc
aagctccccctgattggcggccacgagggcgccggcgtggttgttgccaagggcaagaac
gtgaccacctttgagattggcgactacgccggtatcaagtggatcaacaaggcctgctac
acctgcgagttctgccaggtggcggccgagcccaactgccccaaggccaccatgtccgga
tacacccacgacggctctttccagcagtacgccaccgccaacgctgtccaggccgcccac
atccccaagaactgtgacctcgcccaggttgcccccattctctgcgccggtatcaccgtc
tacaaggctctcaagaccgctggcctcaaggctggtgagtgggccgccgtgaccggagct
ggaggaggcctcggctctctggccgtccagtacgccaaggccatgggctaccgagtgctg
gccattgacactggcgctgacaaggagaagatgtgcaaggagctcggcgccgaggtcttc
atcgactttgccaagtccaaggatctggtcaaggacgtccaggaggccaccaagggcgga
ccccacgccgtcatcaacgtgtctgtctccgagtttgccgtcaaccagtctgttgagtac
gtgcgaaccctgggaaccgttgttctggtcggtctgcccgccggtgccgtctgcaagtcg
cccatcttccagcaggttgctcgatctattcagatcaagggctcttacgtcggaaaccga
gccgactcccaggaggccattgagttctttgcccgaggactggtcaagtcccccatcatt
attgttggtctctccgagctcgaatccgtctacaagctcatggaggagggcaagattgcc
ggtcgatacgttctggactgctccaagtaa

DBGET integrated database retrieval system