KEGG   Yarrowia lipolytica: YALI0A17127gHelp
Entry
YALI0A17127g      CDS       T01033                                 

Definition
YALI0A17127p
Orthology
K04646  
clathrin heavy chain
Organism
yli  Yarrowia lipolytica
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:yli00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    YALI0A17127g
Exosome [BR:yli04147]
 Exosomal proteins
  Proteins found in most exosomes
   YALI0A17127g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:complement(1758952..1763667)
Genome map
AA seq 1571 aa AA seqDB search
MHPTDFVIAVRSKEGALQAFNLETKQRLGSSQLSVPVVFWTWVDAETIGIITETEILHWK
VGTTDPVKLTDRHHSLNDCQVINYISNGSWSALVGITQRDGRIAGQIQLYSKERNVSQAI
EGHAATFTKLQLQDGASPSDLFVFANRGKLHAVEIDHKDENPVYQKKQVDIFFPPEAAND
FPVAVFAAEKYGVVYVVTKYGFVHVYDLEQGLCIYMNRISSESVFTAASYQKKGVLCINR
KGQVLSVELNEQKVVQYILSSLGNAGVALAVASRGGLPGADDLYEQQFSQLLNQGDYANA
AKVAASSPGGRLRTPATIQKLKNVQAPPGGISPILQYFSTLLDKGSLNKVESIELARPVL
QQDRKQLFEKWLQQDKLESSEELGDIVRQFDLKLALQVYVRANVPLKVVAAFAELGEFDN
IVPYCEKVGYTPDYIVLLQNIVRVNPDKGAEFATSLVKKGEDLNLNKVTDIFLSQNHIQA
ATAFLLDALNQNLPEQGNLQTRLLEVNLINAPQVADAILGSDMFSHYDRARIASLCEKAG
LMNRALENYDDLKDIKRVVVHSENFPPDALIAYFGKLTVDQTLECLKEMLKFNIRQNLQV
VVQIATKYSDLVGSLNLIKVFEEFNSQEGLYYYLQSIVNLSEDPDVVFKYITAAAAIGQT
NEIERIVRENNHYNAEKVKNFLMKDAHLPDQLPLIIVCDKYDFVHDLVLYLYKNQQYKFI
EVYVQRVNPARTPKVIGALLDVDCDESIIKDLLMSVVGQVPVSELVEEVEKRNKLKLLLP
FLEKTLNGGSRDTALFDALAKIYIDSNNNPEKFLKENNEYNPLVVGKYCEKRDPYLAFIC
YEKGGLDDELVKITNENSMYKQQARYLLAKQDEALWNKVLSGDEHKRQLVDAVVGTAVPE
SDSPEAVSIAVKAFMAADLPAELLELLEKIILEPSPFSENANLQNLMILTAVKADKSRVS
NYIERLDHYDADDIAQICIDNELYEEAYEIHKKHDKHGQVMSVLTDHIMSLDRASDYAEK
VDTPEVYSLLGKAQIDGLRVGDAIKSYIKAKDPSNFAQVIEIASHAGKDEELIDFLKMSR
DISREPAIDSQLLFSYAATDNLRAMQQLLDSPNVANVESVGDKLFADKNYAASKILYSSI
SNWAKLAAVLVYLGDYQGAVDSARKASSVKVWKQVNQACIDNKEFRLAQICGLNLIVHAE
ELQDLVTQYEYHGYFTELISLFEQGLGLERAHMGMFTELAILYSKYSPGQMMEHLKLFWS
RVNIPKVIRACEAAHLWPELVFLYCHYDEWDNAALAIMERSTDAFEHSSFKDIIVKVANL
EIYYKAINFYMKEVPMLVTDLLSVLAARIDVSRVVRMFDKSDNLPMIKSFLVTVLEQNLA
AVNNAYHNILIEEEDYVTLRDAADAYDKYDAIDLAQRLEKHDLIFFRQIAAHLYKKNKKF
AKSITLSKQDKLWKDAIDTAAVSGKQDVCEELLRYFVGTGNKECYVATLYTCYDWLRQDV
VEEVAWRHKLEDYTMPYKINVTRESSSLLHALQKDNEERKAKEAAAAAAESETPIIGGGQ
RLMITQSNGMY
NT seq 4716 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccaccgactttgtgattgccgtgcgatccaaggagggcgccctccaggccttc
aacctcgagaccaagcagcgactgggcagcagtcagctctctgtccccgtggtgttctgg
acctgggttgacgctgagaccattggcatcatcaccgagactgagattctgcactggaag
gttggcaccacagaccccgtcaagctcaccgaccgacaccactcgctcaacgactgccag
gtgatcaactacatctccaacggcagctggagtgctctggtcggcatcacccagcgggac
ggccgaattgcaggccagatccagctctacagcaaggagcgaaacgtgtcgcaggccatt
gagggccacgctgccaccttcacaaagctgcagctgcaggatggagccagcccatcggat
ctgtttgtcttcgccaaccgaggcaagctgcacgccgtcgagattgaccacaaggacgag
aatcccgtctaccagaagaagcaggtggatatcttcttcccccccgaggccgccaacgat
ttccccgtggctgtctttgccgccgagaagtacggcgttgtctacgtcgtgaccaagtac
ggttttgttcacgtctacgacctggagcagggtctgtgcatctacatgaaccgaatctcc
agcgaatccgtcttcaccgccgcaagttaccagaagaagggtgtcctgtgtatcaaccga
aagggacaggtgctttccgtcgagctcaacgagcagaaagttgtccagtacattctgagc
agtcttggtaacgccggtgtcgctctggctgtcgcctctcgtggaggcctccccggcgcc
gacgacctgtacgagcagcagttctcccagctgctcaaccagggcgactacgccaacgcc
gccaaggtggctgcttcttcacccggtggccgactgcgaacccctgccaccatccagaag
ctcaaaaacgtgcaggcaccccctggcggcatctcgcccattctgcagtacttctccact
ctgctcgacaagggttctttgaacaaggtcgagtctattgagttggcgcgacccgtgctg
cagcaggaccgaaagcagctgtttgagaagtggctgcagcaggacaagctcgagtccagc
gaggagcttggagacattgtgcgacagttcgatctcaagctcgctctgcaggtctacgtt
cgagccaacgtgcctctcaaggttgtggctgcttttgccgagctcggtgagtttgacaac
attgtgccctactgcgagaaggtcggatacactcccgactatattgtcctgcttcagaac
attgtgcgggttaaccccgacaagggtgccgagttcgccacctcgcttgtaaagaagggc
gaggatcttaacctcaacaaggtgaccgacattttcctgtctcagaaccacattcaggcc
gccaccgcctttttgctggatgcgctgaaccagaaccttcccgagcagggcaacctgcag
acacggcttctggaggtcaacctgatcaacgctccccaggttgctgacgccattctgggc
tccgacatgttctcccactacgaccgtgctcgaattgcctctctgtgtgagaaggctggt
ctgatgaaccgggctctggagaactacgacgacctcaaggacatcaagcgtgttgttgtg
cactccgagaacttccctcccgatgctctgattgcctactttggcaagctcaccgtggac
cagactctggagtgtctcaaggagatgctcaagttcaacatccgacagaacctgcaggtt
gttgtgcagattgccaccaagtactctgatctggtgggctcgctcaacctcatcaaggtg
tttgaggagttcaactcccaggagggtctctactactacctgcagtccattgtaaacctg
agcgaggaccccgatgtggtgttcaagtacatcactgctgccgctgccattggccagacc
aacgagatcgagcgaattgtgcgggagaacaaccactacaacgccgagaaggtgaagaac
ttcctcatgaaggatgcccacctgcctgaccagctgcctctgatcattgtctgcgacaag
tacgactttgtgcacgacctggtgctctacctgtacaagaaccagcagtacaagttcatt
gaggtgtacgtgcagcgagtcaaccctgcccgaactcccaaggtgattggtgctcttctc
gacgttgactgtgacgagtccatcatcaaggatctgctcatgtcggttgttggccaggtc
cccgtgtccgagctcgtcgaggaggtcgaaaagcgaaacaagctcaagctgctgctgccc
ttcctcgagaagactctcaacggtggttctcgagacaccgctctgtttgatgctcttgcc
aaaatttacattgacagcaacaacaaccccgaaaagttcctcaaggagaacaacgagtac
aaccccctggttgtcggaaagtactgtgagaagcgagacccctacctggctttcatctgt
tacgagaagggcggtctggacgacgagcttgtcaagatcaccaacgagaacagcatgtac
aagcagcaggctcgatacctgctggccaagcaggacgaggctctgtggaacaaggttctc
tctggcgacgagcacaagcgacagcttgtcgacgctgttgtcggcactgctgtgcccgag
tccgactctcctgaggccgtttccatcgccgtcaaggccttcatggctgccgatctcccc
gctgagctgctcgagctgctcgagaagatcattctcgagccctctcctttcagcgagaac
gccaacctgcagaatctgatgattctgaccgccgtcaaggccgacaagtctcgagtcagc
aactacatcgagcgtctggaccactacgatgccgacgacattgctcagatctgtatcgac
aacgagctgtacgaggaggcctacgagatccacaagaagcacgacaagcacggccaggtc
atgagcgtcctgaccgatcacatcatgtctctggatcgagcctccgactacgccgagaag
gtcgacacccccgaggtgtactctctgcttggtaaggctcagatcgatggtctgcgagtt
ggcgatgccatcaagtcttacatcaaggccaaggatccctccaactttgcccaggtcatc
gagattgccagtcatgccggcaaggacgaggagctgattgatttcctgaagatgtctcga
gacatttctcgggagcctgccattgactctcagctgctcttctcttacgctgccactgat
aacctgcgagccatgcagcagctgcttgactcgcccaacgttgccaatgtggagtctgtg
ggagacaagctgtttgccgacaagaactacgccgcctccaagattctgtactcttccatc
tccaactgggctaagctcgccgctgtgctcgtctacctcggtgactaccagggagctgtc
gactctgctcgaaaggcgtcctccgtcaaggtgtggaagcaggtcaaccaggcttgtatc
gacaacaaggaattccgactggcccagatctgtggtctcaacctgattgtgcacgccgag
gagctgcaggatctcgtcacccagtacgagtaccacggctacttcaccgagctcatttct
ctgtttgagcagggtctcggtctggagcgtgcccacatgggtatgttcaccgagctggcc
attctgtactccaagtactcccctggccagatgatggagcacctcaagctcttctggtct
cgtgtcaacatccccaaggtgatccgagcctgcgaggctgcccacctgtggcccgagctt
gtcttcctgtactgccactacgacgagtgggacaacgctgctctggccatcatggagcga
tccactgatgcgtttgagcactcctccttcaaggacattattgtcaaggtggccaacctg
gagatctactacaaggccattaacttctacatgaaggaggttcccatgctggttactgac
ctgctgtctgtgcttgctgcccgaatcgacgtgtctcgagttgtgcgaatgtttgacaag
tccgacaacttgcccatgatcaagtctttccttgtgactgtgcttgagcagaacctggct
gccgtcaacaacgcctaccacaacattctgattgaggaggaggactacgtgactctgcga
gatgccgctgacgcctacgacaagtacgatgccatcgatctcgcccagcgactcgagaag
cacgaccttatcttcttccgacagattgctgcccatctgtacaagaagaacaaaaagttt
gctaagtccatcactctgtccaagcaggacaaactgtggaaggacgctatcgacactgct
gccgtgtcgggcaagcaggacgtgtgtgaggagctgctgcgatactttgtcggtaccggc
aacaaggagtgctacgtcgcaactctgtacacctgttacgactggctgcgacaggatgtc
gtggaggaggtcgcctggagacacaagctggaggactacaccatgccctacaagatcaac
gtcacccgggagagctcttctctgctgcatgcgctccagaaggacaacgaggagcgaaag
gccaaggaggctgccgctgctgctgccgagagcgagacccccatcattggtggaggtcag
cggctcatgatcacccagagcaacggaatgtactag

DBGET integrated database retrieval system