KEGG   Yarrowia lipolytica: YALI0A19074gHelp
Entry
YALI0A19074g      CDS       T01033                                 

Definition
YALI0A19074p
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
yli  Yarrowia lipolytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YALI0A19074g
Enzymes [BR:yli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     YALI0A19074g
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     YALI0A19074g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:complement(join(2051834..2056109,2056171..2056379))
Genome map
AA seq 1494 aa AA seqDB search
MSYYVLPLNNDGKPRPLGKGSLISLPVPNPSYHLRLVVSSVSDISRNGKILTNVPKKGDD
FDRTKYQAFEISSSFEKECYVDIPIYAPGAYSFYAEFETPRKDFFNASEESHSTGKTEEY
YFNVSSGYTLNGEPVPFSALTLISIISKWMGPYKTWDSKLQFIKDTGYNMIHFTPLQTRG
ESNSPYSIFDQLEFDKEIFPNGDSDVAELVDKMEKKYDMLAMIDIVLNHTANNTTWLEEH
PEACYNVETAPHMESAIVLDDAIIEFSDGVGLVRDPGHLDEIMSNFKDTVSGLDLWQFYV
LDVSKNVDAIAAAWSSLSYIDNLPDWAHDLKGVAKYVTEEAVENAHILGARFGKKVDAAK
AAGIIATYLSKLESTDAKAFPADMVKSEVKKVLDEVNDPFYKEYNADQVTILDQVKNRVS
YTRLDENGPQHGQEVSKKSPLVETYYTRITSKDGKKLHLANNGWMWGANPLVDFASNKSK
AYLLRQVIIWGDCVKLRYGKKPEDSPWLWDHMATYVQTCAKYFHGVRVDNCHSTPLPVGQ
YLLDKARKVRPNLFVVAELFTGSEEEDRIFVERLGITALIREAMQADNVAQLSTLVHKHG
GRPIGSFFEQSLAHCTQDGVERVDVAGDRLDINLVRKSNVDALFMDCTHDNNPPAQKRTV
EDTLPNAALVAMCACSVGSNMGYDQVYPKLLDVVGEDRAYNFDGGISKIKAQLYAVHEEL
GRKHAEETFIHHEGQFITVHRLSPIDGHGYFLVARTKFEEHTPEQTIAPITLSGSKAEQV
LAVKLVKTGDPEKSDKEIFGIPTKVEELGDADIKFENGTTTITLPDFPAGSIALFKTNYV
EVDKEMDEFVRTGADEAVSNFDLLDLNVVLYRAESEERDFSGGKDGVYEVPGYGKLTYAG
IQGWVSPLISIVADNNLGHPLCEHLRQGNWAMGYTVDRLGKYEEEYPDVATFKKWLKSRF
DRISSLPNFLHPRYFALIIYTAYAALRNKALSLLDSSISDSTIFVQNLALTSIQMIGKIP
SASVFPDKVVASLAAGLPHFSVDYMRCWGRDVFISIRGLALCTGRFDIVKSHILGFAKTL
KHGLIPNLLDSGRNPRYNARDATWFFLEAIQDYVKFAPDGEKILDEKITRRFPLDDKYVP
VDSPEAFQTTSTIREVIYEIFTRHAKGIEFREANAGPDIDSQMKSEGFNQKITVDWSNGL
IFGGNQWNCGTWMDKMGESAKAGNKGYPGTPRDGSAIEIAGLLKSSLRFVNELNKKGLFE
WTEVENQDGNKVKFVDWEKKVQDSFEHCYWVPEEASQDKDYDVDSSIVNRRGIYKDLYRS
GKPYEDYQLRPNFAIAMSVAPELFTVDKALHALSVADKAIRGPVGMATLDPSDLNYRPYY
LNSVDSDDFATSKGRNYHQGPEWVWNIGYFFRAFLHFGLAQFEHPSKEARDSVYQQLSSR
LEEHRKWIHESPWAGLTELTQKDGELCGDSSPTQAWSSSTLIDLVFDANLIEKN
NT seq 4485 nt NT seq  +upstreamnt  +downstreamnt
atgtcatactacgtcttgcccttgaacaacgacggcaaaccccggcctctgggcaaggga
tctttgatctcgctgccggttcccaacccgagctaccacctgcgtctggtggtgtcttcg
gtcagtgacatttctcgaaatggcaagatcctgaccaacgtgcccaagaagggcgacgat
tttgaccgaaccaagtaccaggcttttgaaatctcctcttccttcgaaaaggagtgctac
gttgacatccctatctacgcccccggagcctactcgttctacgctgaatttgagaccccc
cgaaaggactttttcaacgcctccgaagagtctcactccaccggcaagacagaggagtac
tactttaacgtgtcttctggctacaccctcaatggcgagcccgtgcccttctcggccctt
actctgatctccatcatctccaagtggatgggcccctacaagacctgggacagcaagctg
cagttcatcaaggacaccggatacaacatgatccactttactcctcttcagacccgagga
gagtccaactcgccctactccatctttgaccagctagagtttgacaaggaaatcttcccc
aacggcgattccgacgtggccgagcttgtcgacaagatggagaagaagtacgacatgctt
gccatgattgatattgtgctcaatcatactgcgaacaacactacctggctggaagagcat
cccgaggcctgctataatgtcgagaccgctccccacatggagtctgccattgttctcgac
gacgccattatcgagttttccgatggagtcggacttgttcgagaccctggacacctggat
gagattatgagtaatttcaaggacaccgtctctggccttgatctgtggcagttttacgtt
ctggatgtttctaagaatgtggacgccattgctgcagcctggtcctctctttcgtacatt
gacaaccttcccgattgggcccatgatctcaagggagttgccaagtacgtgacggaggag
gctgttgagaacgcccatattcttggcgctcgatttggtaagaaggttgatgcggccaag
gccgctggaatcattgccacctatctttccaagctggagagcactgatgccaaggccttc
cctgccgatatggtcaagtctgaggtcaagaaggtgcttgatgaagttaacgaccccttc
tacaaggagtacaacgccgaccaggtcaccattctggaccaggtgaagaaccgagtttcg
tacactcgactggacgagaatggacctcagcatggccaggaggtgtctaagaagtcccct
ctggtggagacttactacacccgaatcacctccaaggacggcaagaagctgcatctggcc
aacaatggatggatgtggggagccaaccctctagttgacttcgcttccaacaagtcgaag
gcctatttgcttcgacaggtgatcatttggggcgattgcgtcaagcttcgatacggtaag
aagcctgaggactcgccctggctgtgggaccacatggccacgtacgtgcagacttgtgcc
aagtacttccatggtgttcgagtcgacaactgtcactccactcctcttcctgtcggccag
tatctgcttgacaaggctcgaaaggtgcgacctaacctcttcgttgttgccgagctgttt
actggctccgaggaagaagatcgaatcttcgttgagcgtctcggtatcactgctctgatt
cgagaggctatgcaggcggacaacgttgcccagctgtccactcttgttcacaaacacggc
ggtagacccattggctccttctttgagcagtctctggctcattgtactcaggatggtgtt
gaaagagttgatgttgctggtgatcgtctggacatcaacttggttcgaaagagcaacgtc
gatgctctgttcatggactgcactcacgacaacaacccccctgcccagaaacgaactgtg
gaggacactctgcccaacgccgctttggttgccatgtgtgcctgttccgtgggctccaac
atgggctacgatcaggtgtaccccaagctgcttgatgttgtgggcgaggatcgtgcatac
aactttgatggcggcatttcgaagatcaaggctcagctgtacgctgttcacgaggagctt
ggccgaaagcatgccgaggagaccttcattcaccacgaaggccaatttattactgtgcac
cgactgtcccctattgacggtcatggatacttcctggttgctcgaaccaagtttgaggag
cacacccccgagcagactattgctcccattactctgtctggttccaaggccgagcaggta
ctcgctgtgaagctcgtcaagactggagaccccgaaaagtccgacaaggagatctttggt
atccccaccaaggtcgaggagcttggagacgccgatatcaagtttgagaacggcactacc
actatcactcttcctgacttccccgcgggctccattgcgctcttcaagacaaactacgtg
gaggtggacaaggagatggacgagtttgtgcgaactggcgccgacgaggccgtgtccaac
tttgacttgctagacctcaacgtggttctttaccgagccgagtccgaggagcgagatttc
tctggcggaaaggacggcgtctacgaggttcccggctacggaaagctcacctatgccggc
atccagggttgggtgtcccctcttatttcaattgtggcagataacaaccttggtcatcct
ctgtgcgagcaccttcgacagggcaactgggccatgggctacaccgtagaccgtctgggc
aagtacgaagaggagtaccctgacgtcgccaccttcaagaagtggctcaagagccggttc
gaccgaatctcttctcttcccaacttcctgcatccccgatactttgcccttatcatctac
actgcctatgctgctctgcgaaacaaggcgctctctctgctggactcttctatcagcgac
tcgaccatttttgtgcagaaccttgctctgacgtccatccagatgattggaaagatccct
tctgcctctgtcttccctgacaaggtcgttgcttccctggctgccggtctgccccacttt
tccgtggactacatgcgatgttggggccgagatgtgttcatctccattcgaggtcttgct
ctgtgcactggtcgattcgacattgtgaagtcgcacatcctcggttttgccaaaactctc
aaacatggtctgatccccaacctacttgactctggcagaaaccctagatacaatgcccga
gatgccacatggttcttcttggaggccatccaggactacgtcaagtttgcccctgacgga
gagaagattctggacgagaaaatcacccgacgattccccctggacgacaagtacgtgcct
gtcgactctccggaggccttccagaccacttccaccatccgagaagtcatctacgaaatc
ttcacccgtcacgccaagggcattgagttccgagaggccaatgctggccctgacattgac
tcgcagatgaagtctgagggtttcaaccagaagatcactgtcgactggagcaacggtctc
atctttggaggtaaccagtggaactgtggaacctggatggataagatgggtgagagtgcc
aaggctggcaacaagggctaccccggtactcctcgagatggatctgccattgagattgcc
ggcctgctcaagtcttcgctgcggttcgtcaacgagctcaacaagaagggtctgtttgaa
tggaccgaggtggagaaccaggacggcaacaaggtcaagtttgtcgactgggagaagaag
gtgcaggactcgtttgagcactgctactgggtgcccgaggaggcttcccaggacaaggac
tacgatgtggactcctctatcgtcaaccgacgaggcatctacaaggatctgtaccgatct
ggcaagccctacgaagattaccagcttcgacccaactttgccattgccatgtctgttgcc
cccgagctcttcaccgtggacaaggctctgcacgctttgtcggtggctgacaaggccatt
cgaggtcccgtcggtatggctacccttgatccctccgatctcaattaccgaccctactac
cttaacagtgtggacagcgacgactttgccacttccaagggccgaaactaccatcagggt
cctgaatgggtgtggaacatcggctactttttccgagccttcctgcatttcggactcgcc
cagttcgagcatcccagcaaggaggcccgagactccgtctaccagcagctgtcttcacgt
ctggaggaacaccgaaagtggatccacgagtctccttgggctggactcaccgagctcact
cagaaggacggcgagctgtgtggagactcttctcccacccaggcatggtcttcttccact
ttgattgaccttgtttttgacgccaatctcattgagaaaaactaa

DBGET integrated database retrieval system