KEGG   Yarrowia lipolytica: YALI0A19206gHelp
Entry
YALI0A19206g      CDS       T01033                                 

Definition
YALI0A19206p
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
yli  Yarrowia lipolytica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YALI0A19206g
  Amino acid metabolism
   00330 Arginine and proline metabolism
    YALI0A19206g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     YALI0A19206g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:complement(join(2066070..2067307,2067739..2067772))
Genome map
AA seq 423 aa AA seqDB search
MASLYTIVIKLGTSSLVDEVTREPRIANMSLLVETIVKLKRDGHRVIIVSSGGIAVGLKR
LGITDRPKGIAEVQAVAAVGQARLIGLWDDLFRQMGQPIAQILLTRNDLADRTQYLNATA
TLNELLNMGVIPIVNENDTLSAYEIRFGDNDTLSAITAGMANADYLFLMTDVDCLYTANP
RSDPTAKPILIVDDISSLKVDVSSTGSNVGTGGMTTKLIAAELATSVGTTTVICKSSVPG
NIRAIVKYNQKYDVEADAKEIVTPAYQAQELERLVVEDVPLHTKFIADKEPIKDRQFWLL
HGLSAAGKIYIDAGCYKALTRKNRAGMLPAGLLGTVGTFHTSETVSIHVGRKLEDGGWIP
HPDFADMEVGRALVNYGSTEMELIKGLQSNQIESVLGFMDSEYLAFRDNIAFLPHTNAPS
SPA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctttacacaatcgttatcaaactgggaacctcgtccctcgtcgatgaggtc
acacgagaaccccgaatcgccaacatgtctctgttggtcgagaccatcgtcaagcttaag
cgagacggccacagagtcatcattgtctcgtccggaggtattgctgtgggtctcaagcgt
ctcggtatcaccgatcgacccaagggtatcgccgaggtccaggctgttgcagccgtcgga
caggcccgtcttattggtctatgggacgatctcttcagacagatgggtcagcccattgca
cagattctgctgacccgaaacgatctggccgaccgaacccagtacctcaacgccacagcc
actctcaatgagctgctgaatatgggtgttatccccattgtcaacgagaacgacactttg
tccgcctacgaaatccgattcggagataatgacactctgtctgccatcactgccggaatg
gccaacgccgactacttgttcctcatgactgacgtcgactgtctctacactgccaacccc
agatccgaccccaccgcaaagcccattctcattgtcgatgatatctcctccctgaaggtt
gatgtcagctctaccggctccaacgtcggaaccggaggtatgaccaccaagctgattgca
gctgagctggccacttctgtcggaaccaccaccgtcatctgcaagtcttccgtccccgga
aacatccgagctatcgtcaaatacaatcagaagtacgacgtcgaggccgacgccaaggag
attgtcactcccgcttaccaggcccaggaactggagcgactggtggtcgaggacgtgcct
ctgcacaccaagttcatcgccgacaaggagcccatcaaggatcgacagttctggctgctg
catggtctcagtgccgctggaaagatttacatcgatgctggctgctacaaggctcttaca
cggaagaatcgagctggtatgctccccgccggtctcctcggaaccgtcggcaccttccac
acatccgagaccgtgtctatccacgttggtcgaaagctggaggatggtgggtggatcccc
catcccgactttgccgatatggaggttggacgagctcttgtcaactacggctccactgaa
atggagctcatcaagggcctgcagagtaatcagatcgagagtgttcttggattcatggat
tccgaatatcttgcattccgagacaacattgccttcctgccccatactaatgccccctcc
agtcctgcttag

DBGET integrated database retrieval system