KEGG   Yarrowia lipolytica: YALI0A19206gHelp
Entry
YALI0A19206g      CDS       T01033                                 

Definition
(RefSeq) YALI0A19206p
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
yli  Yarrowia lipolytica
Pathway
yli00330  Arginine and proline metabolism
yli00332  Carbapenem biosynthesis
yli01100  Metabolic pathways
yli01130  Biosynthesis of antibiotics
yli01230  Biosynthesis of amino acids
Module
yli_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    YALI0A19206g
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    YALI0A19206g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     YALI0A19206g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 2906058
NCBI-ProteinID: XP_500235
UniProt: Q6CGH7
Position
A:complement(join(2066070..2067307,2067739..2067772))
Genome map
AA seq 423 aa AA seqDB search
MASLYTIVIKLGTSSLVDEVTREPRIANMSLLVETIVKLKRDGHRVIIVSSGGIAVGLKR
LGITDRPKGIAEVQAVAAVGQARLIGLWDDLFRQMGQPIAQILLTRNDLADRTQYLNATA
TLNELLNMGVIPIVNENDTLSAYEIRFGDNDTLSAITAGMANADYLFLMTDVDCLYTANP
RSDPTAKPILIVDDISSLKVDVSSTGSNVGTGGMTTKLIAAELATSVGTTTVICKSSVPG
NIRAIVKYNQKYDVEADAKEIVTPAYQAQELERLVVEDVPLHTKFIADKEPIKDRQFWLL
HGLSAAGKIYIDAGCYKALTRKNRAGMLPAGLLGTVGTFHTSETVSIHVGRKLEDGGWIP
HPDFADMEVGRALVNYGSTEMELIKGLQSNQIESVLGFMDSEYLAFRDNIAFLPHTNAPS
SPA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctttacacaatcgttatcaaactgggaacctcgtccctcgtcgatgaggtc
acacgagaaccccgaatcgccaacatgtctctgttggtcgagaccatcgtcaagcttaag
cgagacggccacagagtcatcattgtctcgtccggaggtattgctgtgggtctcaagcgt
ctcggtatcaccgatcgacccaagggtatcgccgaggtccaggctgttgcagccgtcgga
caggcccgtcttattggtctatgggacgatctcttcagacagatgggtcagcccattgca
cagattctgctgacccgaaacgatctggccgaccgaacccagtacctcaacgccacagcc
actctcaatgagctgctgaatatgggtgttatccccattgtcaacgagaacgacactttg
tccgcctacgaaatccgattcggagataatgacactctgtctgccatcactgccggaatg
gccaacgccgactacttgttcctcatgactgacgtcgactgtctctacactgccaacccc
agatccgaccccaccgcaaagcccattctcattgtcgatgatatctcctccctgaaggtt
gatgtcagctctaccggctccaacgtcggaaccggaggtatgaccaccaagctgattgca
gctgagctggccacttctgtcggaaccaccaccgtcatctgcaagtcttccgtccccgga
aacatccgagctatcgtcaaatacaatcagaagtacgacgtcgaggccgacgccaaggag
attgtcactcccgcttaccaggcccaggaactggagcgactggtggtcgaggacgtgcct
ctgcacaccaagttcatcgccgacaaggagcccatcaaggatcgacagttctggctgctg
catggtctcagtgccgctggaaagatttacatcgatgctggctgctacaaggctcttaca
cggaagaatcgagctggtatgctccccgccggtctcctcggaaccgtcggcaccttccac
acatccgagaccgtgtctatccacgttggtcgaaagctggaggatggtgggtggatcccc
catcccgactttgccgatatggaggttggacgagctcttgtcaactacggctccactgaa
atggagctcatcaagggcctgcagagtaatcagatcgagagtgttcttggattcatggat
tccgaatatcttgcattccgagacaacattgccttcctgccccatactaatgccccctcc
agtcctgcttag

DBGET integrated database retrieval system