KEGG   Yarrowia lipolytica: YALI0A19712gHelp
Entry
YALI0A19712g      CDS       T01033                                 

Definition
YALI0A19712p
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
yli  Yarrowia lipolytica
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YALI0A19712g
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YALI0A19712g
   04113 Meiosis - yeast
    YALI0A19712g
Protein phosphatases and associated proteins [BR:yli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     YALI0A19712g
Ubiquitin system [BR:yli04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     YALI0A19712g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:complement(2127220..2129088)
Genome map
AA seq 622 aa AA seqDB search
MNQLAASFWHAIDYNLIPTAAFTVERMLAIDPSSENVHLHALVLDRQGRHKAVLMATKTH
LSHIGCLYLYAESCLKLQKHADGARVLEAGKKTWLNGTYTAHSATQRSVIPDPSAFLVLL
GKLYQGAGNITVAAEAYAMALSQNPFVWEAFERLTEMGINVNVANIFKPGYQYPVEDPFQ
GGKLGFGGNNSAGSNNSVNTNPSASSTGQQQSNLTTTFQGGSLGKGKFLGGKSSLYDTPT
SRPKRVGFAGSTLGAGLNIANTLPSGQTIGGASTASNSSSAPPSSASSATHSSATLPLYT
KIARGVLAFSRYELQTALKHFLDLPSIHRDSAYVLAKIGRIYFEQVNYAEAERTFARLRE
LDRTRVADMEVYSTTLWHLQKDLELAYLSRDLLDSDRSSPQAWCVLGNSFSVQREPELAL
RCFKRATALDPQFAYAYTLSGHEHVTSEALEQAQDAFRMALRCDSRHYNAWYGLGMVSMK
LGDFERAEFHFKSALAINSNNVVLVCCVGMILERQNMLQQALAMYTRATTLQPQSALSRY
KKARILMQLQRFNEALVEFDLLQTLAPDEASVHFLLGQLYKAVNKKPLAVKHYTIALNLD
PKGSHLVREAIENLSMDGSVDA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaactggcagcgtccttctggcatgctatcgattacaacttgatccccacggcg
gcctttaccgtcgagcgcatgttggcaattgacccctcttcggaaaacgtccatttgcat
gcgctggttctggatcgccagggacgtcacaaggcagtcttgatggccacaaaaacacac
ctgtcccacattggttgtttgtatctgtacgctgagtcgtgtcttaagctgcagaagcat
gctgacggtgcccgggtcctcgaggccggcaaaaagacatggctcaatggcacgtacacg
gcccattctgcgacacaacgaagcgtgattccagacccttcggcctttttggtactgcta
ggaaagctgtatcagggcgcaggaaacattaccgtggccgcagaggcctacgccatggca
ctgagccagaacccgtttgtctgggaggcttttgaacggctcacagaaatgggaattaac
gtcaacgtcgccaacattttcaaaccaggataccaataccccgtggaggatccctttcag
ggaggcaagctgggattcggtggcaacaacagtgctggcagcaataacagcgtcaacaca
aacccatcggcttcttcaaccggacaacaacaatctaatcttaccaccaccttccaggga
ggctcgctaggaaagggcaagttcctcggaggcaaaagctcgctgtacgacacgcctaca
tcacggccaaaacgcgttggatttgccggatcaactctgggagcgggtctcaacatagct
aacactctccccagtggccaaacaattggcggcgcttctacggcatccaactcctccagc
gcacccccttcttctgcatcttcggccactcactcctcggccaccctccctctctacacc
aaaattgctcgtggcgttcttgccttctcacgatacgagctacagacggcgcttaaacac
tttctggaccttccgtcaatccaccgagactctgcctacgtgctggccaagataggccgc
atctactttgagcaggtcaactacgcggaggcagaacggacttttgctcggctcagagag
ctggatcgaacccgtgtggccgacatggaggtctactccacgaccctgtggcatctgcag
aaggacctcgagcttgcatacctgtcgcgagatctgctggactcggaccggtcgtctcct
caggcgtggtgtgttttgggcaactcgttctcagtccaacgagaacccgaactggcgctc
aggtgtttcaagcgggccacagctctcgacccgcaatttgcatatgcatacaccctcagt
ggtcatgagcacgtgacgtctgaggctcttgagcaggcccaagatgcgttccgaatggct
ctgcggtgcgactcgcggcattacaatgcgtggtatggtctgggaatggtgagcatgaag
ctgggtgactttgagcgggctgagttccacttcaagtcagctctggccatcaacagcaac
aatgttgtgcttgtgtgctgcgtgggaatgatactggagcgacagaacatgttgcaacag
gcgttagcaatgtacacgcgggccacgactctccagccgcaatcggccctttctcgctac
aagaaggcccggatccttatgcaactccagcggttcaacgaggctcttgtagagttcgat
cttctgcagactctggctccagacgaagcttcggtccatttcttgctgggccagctatac
aaggctgtcaacaagaagcctttggcggtgaagcactacaccattgctctgaatcttgat
cccaagggcagtcatttggtgcgggaggcgattgagaatctcagcatggacggcagtgtg
gatgcatag

DBGET integrated database retrieval system