KEGG   Yarrowia lipolytica: YALI0A19976gHelp
Entry
YALI0A19976g      CDS       T01033                                 

Definition
YALI0A19976p
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
yli  Yarrowia lipolytica
Brite
Protein phosphatases and associated proteins [BR:yli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     YALI0A19976g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:2154102..2154623
Genome map
AA seq 173 aa AA seqDB search
MADERSKLEQAGEGTNFSSDEIDRLRKRFMKLDTDASGILETNEFLSLPGVAANPLASRL
MDVFDENHSGDVDFQEFINGLSTFSTKGNKKEKLRFAFKVYDIDRDGYISNGELFIVLKM
MVGNNLKDAQLQQIVDKTIMEADKDGDGKISFEEFEAQVGGTNVYQSMTLDLF
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaaagaagtaaacttgagcaagctggagagggcaccaacttctcgtcagac
gaaatcgaccggctgagaaagcggttcatgaagctggacactgacgcctctggaattctg
gaaaccaacgagtttctgtcactgcctggcgtggctgccaacccgctggcgtcgcggctg
atggatgtatttgacgagaaccactccggtgacgtagacttccaggagttcatcaatggt
ctcagcacattttccaccaagggaaacaagaaggagaagctgcggtttgcattcaaggtg
tacgacattgatcgagacggctacatttccaacggagagctattcattgtgctgaagatg
atggttggcaacaacctcaaggacgcccagctgcaacagattgtcgacaagaccataatg
gaggctgataaggacggggacggcaagatttcctttgaagagttcgaggcccaggtcgga
ggcacgaacgtttaccagagcatgactctggatctcttttag

DBGET integrated database retrieval system