KEGG   Yarrowia lipolytica: YALI0A21153gHelp
Entry
YALI0A21153g      CDS       T01033                                 

Definition
(RefSeq) YALI0A21153p
  KO
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
yli  Yarrowia lipolytica
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YALI0A21153g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     YALI0A21153g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:2262766..2263377
Genome map
AA seq 203 aa AA seqDB search
MAALIIVDLQNDFLPGGSLAVVDGNDIIPIVQKLADSGKYKFVVATKDSHPQDHTSFAAN
HGAEPFTSITFKHPNSDKQVDHTVWPVHCVEGTSGADYPPSFDSSNVQALVRKGYLQDRE
YYSGFEDVWGIHKTELHDLLQQNGVTEVDVVGLAFDYCVFNTAKDAAKRGYKTTVIREAT
KPVDPSSEKKIVASLEEAGVHVV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcagcactcatcattgtggacttgcaaaatgactttcttcctggaggctctcttgct
gtagtcgacggaaatgacatcatacccattgttcagaaactcgctgactctggcaagtac
aaatttgtggtggccaccaaagacagtcatccccaagaccacacatcgttcgccgccaac
catggagctgagccgttcacctcaatcacattcaagcaccctaactcagacaaacaggta
gaccataccgtgtggcctgttcattgtgtggagggtacttctggggcagattaccctcct
tcattcgactcgtccaatgtgcaggctcttgttcgaaagggatacttgcaggacagagag
tattattctggatttgaggacgtttggggcatccacaagacagagcttcatgacctgttg
cagcaaaatggcgttacggaggttgacgtggtgggacttgcatttgattattgtgtgttc
aatacagctaaagacgctgccaaacgcggctataaaaccacagtcattagggaagccacc
aaacctgtggatccttcttctgaaaaaaagattgttgctagtcttgaagaggctggggtt
catgtcgtctga

DBGET integrated database retrieval system