KEGG   Yarrowia lipolytica: YALI0B02750gHelp
Entry
YALI0B02750g      CDS       T01033                                 

Definition
YALI0B02750p
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
yli  Yarrowia lipolytica
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YALI0B02750g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:complement(join(411693..416455,416721..416919))
Genome map
AA seq 1653 aa AA seqDB search
MLTWSLELFDRLRDTMQTLSKELHDDDVDANNLRKMLNEVSYLKDDFKMSLDNPKQSASD
RETIQKGKYTFGDDERQLSPEFIEGTLLIADELQLNEAAAAELVEYAISSRQGSDMSLSE
AAIYAYYTRRQRILDTVRFLYFWIHEEKDKPELISELKKIAAVIGPHKEVFDKCVDNMSK
DVNALKDLDEKEKQGVFLGRNQDPKFEATLKLRRDFILQEHEDLGQTITVLILSEKLDFD
SIKKLITAASSLRAYNTLLLHHVPALLSVFGLIEADNIQRLSVGDTLKLRSDLFSKSIEW
GIPTFQRFIQLAFLAGLAALARSDEGLSSQVNFTRDILDVCREAIDEGALEFGYALATDT
AAFNVRNVFYDMRPALQQRVPEFKFLRRLSADFEVLWTRQMQWFISTFISHLPDLLKQMK
QSEEDTFLANEAVSDPDLQLQDDVGRDLERFYMMVSNLYDGHPDAALDYWVDGESDLYGF
VDWASHFADSPLMAATATNMLASLSTGPECASNAHRFLAAELPKTRNPRLTWHQVLDAFD
FYVDALSPQVPERGTTTMPNALVQVAAPVLDRQATMMIEAYMHLVSQVLAYSPEAREYLF
EAGLVDRVFGLLTVETGVTGIVLEALSGLAVDAPLEVKRLLWTRLDAWAFQSVYYTADGR
ILNNNLSPRERLQGLITDLQSAVGFSKLVERLMYPVVDIGGDPIVPALPFPFELGANYRF
PGVWVYVNYMLEDILYYSSVAQLEESQKMILQITCFNFAKSCLRLFNPDTIRLAAAAGVS
LDKIMDNDLTFKQYLIAHPCPLAMALIFNEKLYTIILGLCETSADMSSNLARYEIERTAC
ALAIVDLVFSMEENFIDNMLPVLQEMSKKNDQIISNMSVHSFEEAILFRMTVIPHLAHHM
ASANAGIAATSFSILSRVSQSSLFNDNDGRIATSLEPQNRLLRAFKTYSDAQKIKSGIVE
QLERPFDDYEHEHHKATGLELKLSILQFISSNLGRDSADATVAHFLLGFAINGDGSLAAD
NGTYGVANRNSVFGVILSQLTQSVANIDPCNVFLDSAEFAAECAKVVMHLCRNQNSAAIT
LRILRDFGFFAQILAEEPVTDRQTLWNGQVLDMKKHFIMSPAPAAFSSFFHHRTALFEYF
SMEVHASAVKGSLSVVKRYLDSLVTLDKKPQWHYAASQISTTALSFLDVLEFQWDTRIST
QPDFGLFSSINREYVDKTFGKDKLIDIYGLLTKLYQLRAYELTKTGFVTEDEIPMLDAQM
DELLEFEMGVRASGRMRQRQLDFLNSWCQLVLILLNDCEMNAPDRSVFILEALQKIVPKL
GYYASSDSDFAEVLASLLCSLFEMYRRDIEAMNSSAGRDRSHALFRACIGAIRTPVSTPT
LRSDLYIICHKYLESAASNPSLLKQNYQVVRTSGDKLLETVCSDAISGTTHQRTLALMFL
ESLASLCTRTESPFVLDCLVRYNLLLLLVRSLKTTDQLIHSTSEQLPLDKIMSEVTAFRA
VMFFLLEIAQTRTGAFQVVQCGIFQTLHECLFLNTDPDVGIQLATKEAKKDKTVDPVELY
YQILTPVLRLLTAIVLSMGSENHVTIERVGTILRDRRHLVVALFKKDVLNKSQYKEDDLE
KKSGKKKPLIGTDSLVDAAKLLTVLVTLTDAFK
NT seq 4962 nt NT seq  +upstreamnt  +downstreamnt
atgcttacgtggtctctggagctgtttgatcggctgcgggacacgatgcagacactgtcc
aaggagctccacgacgacgatgtggacgccaacaaccttcggaagatgctgaacgaggtc
tcgtacctgaaggatgactttaagatgtctctggacaatccgaaacagagtgcttctgat
cgggagactatccagaagggaaaatacacatttggagacgatgaacgtcaactctctcct
gagtttatcgagggaacgcttctcatcgcagatgagcttcaactaaacgaagcagctgct
gcagagctcgtcgagtacgccatctcttctcgacaaggctccgacatgtctctcagtgaa
gctgcaatctacgcctactacacacgtcgacaacgtatactcgacacagttcgtttccta
tatttttggattcatgaggagaaggataagcccgaattgattagcgagctcaagaagatc
gcagctgttattggaccccacaaggaagtgttcgacaagtgcgtcgacaacatgtccaag
gatgtaaatgctctgaaggatctggacgaaaaggagaagcagggagtctttctgggccga
aaccaggaccctaagttcgaggcgacactcaaactgcggcgggacttcattctgcaggaa
catgaggatctgggccaaaccatcactgtgttgattctgtccgagaagctcgatttcgac
tccattaagaagctgattaccgctgcttcttcgcttcgagcatataacaccctgcttttg
catcacgtgcctgctttgctgtccgtcttcggtctgattgaagccgacaatatccagcga
ctctctgttggcgacactctcaagctccgaagcgacctgttcagcaagtcaattgagtgg
ggcattcctacattccagcggttcatccagcttgcatttcttgcaggattagctgccctg
gcacgttcagacgaaggtctcagttctcaagtgaacttcacacgcgacatcctcgatgtc
tgtcgagaggctatcgacgagggtgctctggagtttggatacgcattggcaactgacact
gctgcattcaacgtccgaaacgtgttctacgatatgcggcctgctctacagcagcgagtg
cccgagttcaagtttctgcgacgactgtcggctgatttcgaggtactctggacccgtcag
atgcagtggttcattagcacgttcatttcacatcttcccgacttgctcaagcagatgaaa
cagtccgaagaagacactttcctggccaacgaggccgtatctgatcccgaccttcagctt
caagacgatgtgggacgtgatctggaacggttctacatgatggtgtcaaatctttacgat
ggccaccctgatgctgctttggattactgggttgatggcgagagtgatctgtacggtttt
gtggattgggcttctcatttcgccgactctcctctcatggctgctactgccacaaacatg
ctggcttctctatctactggtcccgaatgtgcatccaacgcccaccgatttttggctgct
gagttgcccaaaaccagaaaccctagactcacttggcatcaggttctggacgctttcgac
ttctacgtcgatgctctttccccccaggttcctgagcgtggaaccaccacaatgcccaat
gcgctggttcaagtcgctgcccctgtgctagacagacaggccacgatgatgattgaggca
tacatgcacttggtttcgcaggtgctggcatactcccctgaggcaagagaataccttttc
gaggccggcttggtagatcgagtgtttggattgctgacagttgagactggagtaactgga
attgtcctggaagctctgtccggtctagcagttgatgcccctctggaggtcaagcgactc
ctctggactcgtctggacgcctgggcttttcagtctgtttactacacagccgatggacga
atcctcaacaacaacttgtctccccgtgagcgacttcagggtctcatcaccgatcttcag
agtgctgttggattctccaagctcgttgaacggctcatgtaccctgtcgtcgatattggt
ggagatcctattgtgcctgctcttcctttcccattcgagctgggtgccaactacagattc
cctggcgtctgggtgtatgttaactacatgctggaggatattctctactactcttccgtc
gctcaactagaagagagtcaaaaaatgatcctgcaaatcacttgtttcaacttcgcaaag
agttgtctcagactcttcaaccccgacacaatcagacttgccgcagcggctggtgtgtct
cttgacaagattatggacaacgacctgacattcaagcaatacctcattgctcatccttgt
cctctggccatggctttgattttcaacgaaaagctgtacaccattattctgggtctgtgt
gagacgtcagctgatatgtcttctaaccttgctcggtacgagattgagcgaactgcatgt
gctctggctattgtcgatctggtgttcagcatggaggaaaacttcatcgacaacatgctg
cctgttctgcaggagatgagcaagaagaacgaccagatcatcagcaacatgagtgtacat
tcgttcgaggaggccattctcttccggatgactgtcattccccatctagcccatcacatg
gcgtctgccaatgctggcattgctgctacctctttcagcattctgtctcgagtttctcaa
tcgtccctgttcaacgacaacgatggacgaatcgccacgagcctggagccccagaaccgt
ctgctgcgagcattcaagacatactctgacgcccagaagatcaagtctggcattgtggaa
caactcgagcgacccttcgacgactacgagcacgagcatcacaaggctaccggtctggag
ctcaagctgtcgattctgcaattcatttcttctaacctgggccgtgattccgctgatgct
accgttgctcatttcctgctcggatttgcaatcaacggagacggctctctggctgccgac
aacggcacttatggtgttgccaatcgaaactccgtctttggggtcattctctctcagctc
actcagtctgttgccaatattgacccttgcaacgtcttccttgactcggctgaattcgct
gctgaatgcgcaaaggtcgtgatgcatttgtgtcggaaccaaaactcggctgccatcacg
ttaagaattttgcgagactttggcttcttcgcccagattctcgctgaggagcctgtcacc
gacagacagactctctggaacggacaggtgctcgacatgaagaaacattttatcatgagt
cctgctcctgcagctttctcttctttcttccaccacagaactgctctcttcgagtacttt
agtatggaggtccacgcttctgctgtcaagggttcgttgtctgtcgtaaagcggtacctg
gactccctggtgactcttgacaagaagccccagtggcactacgctgcttctcagatctcc
acaactgctctttcgttcctggatgttcttgagttccaatgggacactcggatcagcacc
cagcctgatttcggactcttctcgtccatcaaccgagagtatgtggacaagactttcggc
aaagacaagctgattgacatctacggtctgctgacgaagctttaccagcttcgagcttat
gagctgaccaagactggtttcgttactgaggacgagatccccatgttggatgcccaaatg
gacgagcttctcgaatttgagatgggcgtgcgagctagtgggcgaatgcgacagcgacag
ctagatttcctcaactcgtggtgccagttggttctcattttgctcaacgactgtgagatg
aacgctcccgatcggtctgttttcatcctggaggctctacagaagattgtgcccaagctc
ggatactacgcttcttctgactcggactttgctgaggttttagcatctctcctctgctct
ctgtttgaaatgtacagacgagacattgaggcgatgaactcctctgctggtcgagacaga
tcccacgctctgttcagagcctgcattggagccatcagaacgccggtttccacccccaca
ctccgttccgacctgtacatcatctgccacaagtaccttgagtcggcggcctcaaaccct
tctctgttgaaacaaaactaccaggtggtgcgtacttcgggagacaagttgcttgagact
gtttgttccgacgccatttccggaaccacacaccagagaacattggctctcatgttccta
gagtctttggcctccctgtgtaccagaactgaatctcccttcgtcctggactgtctggtt
cgatacaacctgctattgttgctggttcgaagcctgaagactaccgaccagctgattcat
tccacttctgagcagttgcctctcgacaagatcatgtctgaggttacagctttccgagca
gtcatgtttttcctgcttgagattgcgcagactcgaactggagccttccaggtcgtgcaa
tgtggcatttttcagacccttcatgagtgtcttttcctcaacactgaccctgacgttggc
atccagctggctactaaggaggccaagaaggacaagacggtggaccccgtagagctgtac
taccagatcctgactcctgttctgcgtctgcttacagccattgttctttccatgggatcg
gaaaaccatgtgactattgagcgggttggcaccattctgcgagacagacgccatctagtg
gtggctctgttcaaaaaggacgtactcaacaagtctcagtacaaggaggatgacttggaa
aagaagagcggcaagaagaagccgctgattggcaccgacagtcttgttgatgctgccaag
ctgttaacggtgttggttactctcactgatgctttcaaatag

DBGET integrated database retrieval system