KEGG   Yarrowia lipolytica: YALI0B02816gHelp
Entry
YALI0B02816g      CDS       T01033                                 

Definition
YALI0B02816p
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
yli  Yarrowia lipolytica
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:yli04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:421201..422718
Genome map
AA seq 505 aa AA seqDB search
MIRADRHTYKVFNQEFTIDKRFQVTKELGHGAYGIVCAAKYTGTPDGPGVAIKKVTNIFS
KNILCKRALRELKLLNHFRGHKNITCLYDMDIVDTNNFNELYLYEELMECDMHQIIRSGQ
PLTDAHYQSFVYQILAGVKYIHSADVLHRDLKPGNLLVNADCELKICDFGLARGFSSDDE
KNAGFLTEYVATRWYRAPEIMLSFQSYTKAIDIWSVGCILAELLGGKPLFKGKNYVDQLN
QILHYLGTPSEETLKRIGSPRAQEYVRGLPFMPKIPFSTLFPTANPEALDLLEKMLAFDP
AERVTVEEALEHPYLKIWHDPRDEPVCPTPFDFSFEEVNDMEAMKQMILDEVVDFRAMVR
KPVDEQTRIRDEQIEEQRREEEKQEVERQQKEAERQKQHQQEAERQQHQQQQHHPQQQDS
PSTLSGFSDSDQSANPHFYEYAGFGVGSQTSDMGQPPVIQRKDSLGIPEEDFKYQDPPPK
PQESGRQGDGDLELELEYGLDGWRS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgatacgagcggaccgacacacgtacaaggtgttcaaccaggaattcaccatagacaag
cggttccaggtgaccaaagagctgggccatggcgcgtacggcattgtgtgtgcagccaag
tacactgggacgcctgatgggcctggagttgctatcaagaaggtgaccaacattttctcg
aaaaacattctgtgtaagcgggcgttgcgggagctcaagctactgaaccacttccggggg
cacaagaacatcacctgtctgtacgatatggacattgtggacaccaacaatttcaacgag
ctgtatctgtacgaagagctcatggagtgcgatatgcatcagatcatccggtccggccag
cctctgactgacgcccattaccagtcgtttgtttaccagattctcgccggtgtcaagtac
attcattccgccgatgttctccatcgggatcttaaacccggcaatttgctggttaacgcc
gactgtgagctcaagatttgcgatttcggacttgcgcgtggattctcttccgacgacgaa
aagaatgccggtttcctgacagaatacgtcgccacccggtggtacagagccccggagatc
atgctctctttccagtcttacacaaaggccattgacatctggtccgtgggctgcattctg
gccgagcttctgggaggaaagccgctgttcaagggcaagaactacgtcgaccagctcaat
caaattctgcactacctcggaacgccctcggaggagactctcaagcgaatcggcagtccc
agagcccaggagtacgttcggggtcttcccttcatgcccaagattcccttttccacgcta
ttccccaccgccaaccccgaggctctggatctgctggagaaaatgcttgccttcgatcct
gcggagcgagtgacggttgaggaggctcttgagcacccctacctgaagatctggcacgat
ccccgagatgagcctgtgtgtcccactccgttcgacttctcgttcgaggaggtcaatgac
atggaggcaatgaagcagatgattctggacgaggttgtggacttccgggccatggttcga
aagcctgtcgatgagcagacacgaatcagagacgagcagatcgaggagcagcggagagag
gaggagaagcaggaggtggagagacaacagaaggaggctgaacgtcagaagcaacaccag
caggaagctgagagacagcaacaccagcagcagcaacatcaccctcaacagcaggactct
ccatccaccctgtcgggcttctcggactcggaccagtctgctaacccccacttttacgag
tacgccggctttggagtcggctcacagacctcggacatgggccagccacccgtcattcag
cgaaaggactctctgggtatccccgaggaggacttcaagtaccaggacccgccaccaaag
ccccaggagtccggacgccagggagatggcgacctggagctcgagctggagtacggcttg
gatggatggagaagttga

DBGET integrated database retrieval system