KEGG   Yarrowia lipolytica: YALI0B03124gHelp
Entry
YALI0B03124g      CDS       T01033                                 

Definition
YALI0B03124p
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
yli  Yarrowia lipolytica
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    YALI0B03124g
Enzymes [BR:yli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     YALI0B03124g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YALI0B03124g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:455269..456042
Genome map
AA seq 257 aa AA seqDB search
MSTTYKEYDWEKPVQLLYDHINGLPAEELAKFKKDPEALLDAIDKFEEEQHKKDGKYALM
TVGPEKRKVVEEEIAQNKPYTFAELGGFCGYSAIAFAHKLKQTHPGYQVHYYSLEVSPFF
AKVTSRFTTLAGLGDIVTVLVGPAAEGLERLKEEYNHAKIDFFFIDHWKDLYVPDLQKAE
ELGLVQYGTVITADNIYWPGAPEYAKYVRLTPAEKKKEYPGKGNPNIEYDTRTVEVPLGK
DKKDGVEVTLCTGVLTE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtctactacatacaaggaatacgactgggagaagcccgtccaacttctttacgaccac
atcaacggcctgcccgccgaggagctggccaagttcaagaaggaccccgaggctcttctc
gatgcaattgacaagtttgaggaggagcagcacaaaaaggacggcaagtacgctctgatg
accgtcggccccgaaaagcgaaaagtcgtcgaggaggaaatcgcccagaacaagccctat
acctttgccgagctcggtggtttctgcggatactcggctattgcctttgcccacaagctg
aagcagacccaccccggctaccaggtgcactactactctctggaggtgagccccttcttc
gctaaggtgacctcccgattcaccactctcgctggcctcggtgacattgtcactgttctc
gtcggacctgctgcggagggccttgagcgactcaaggaggagtacaaccacgccaagatt
gacttcttcttcattgaccactggaaggacctctacgttcctgacctgcagaaggctgag
gagcttggcctggtccagtacggaactgtcatcacagctgacaacatctactggcctgga
gcacctgaatacgccaagtatgtgcgtctgactcctgccgagaagaagaaggaatacccc
ggcaagggcaaccccaacattgagtacgacacccgaaccgtcgaggttcctcttggaaag
gacaagaaggacggagtggaggttactctctgtactggcgttcttaccgagtag

DBGET integrated database retrieval system