KEGG   Yarrowia lipolytica: YALI0B07183gHelp
Entry
YALI0B07183g      CDS       T01033                                 

Definition
YALI0B07183p
Orthology
K05759  
profilin
Organism
yli  Yarrowia lipolytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
Position
B:join(949388..949400,949468..949835)
Genome map
AA seq 126 aa AA seqDB search
MSWQAYVDNLVGSGKVDKAAIFSRAGDSVWCTTSGFSVAPAEVLELAKGFDDPSPLQAGG
LHIAGQKYFLLRADDRSIYGKHEQSGIIAVRTGQAIIVGHYPEGVQPGEATKVVEALGDY
LINANY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttacgttgacaacctggttggatctggcaaggtcgataaggccgcc
attttctcccgagccggtgactccgtctggtgcaccacctcgggcttctccgtggccccc
gccgaggtcttggagctggccaagggcttcgacgacccctctcctctgcaggctggcggt
ctgcacattgctggccagaagtacttccttctgcgagccgacgaccgatccatctacgga
aagcacgagcagtccggcattatcgccgtgcgaaccggccaggccatcattgtgggccac
taccccgagggcgtgcagcccggagaggccaccaaggtcgttgaggctctgggagattat
ctcatcaatgctaactattag

DBGET integrated database retrieval system