KEGG   Yarrowia lipolytica: YALI0B10406gHelp
Entry
YALI0B10406g      CDS       T01033                                 

Definition
YALI0B10406p
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
yli  Yarrowia lipolytica
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YALI0B10406g
   01212 Fatty acid metabolism
    YALI0B10406g
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YALI0B10406g
   00650 Butanoate metabolism
    YALI0B10406g
  Lipid metabolism
   00062 Fatty acid elongation
    YALI0B10406g
   00071 Fatty acid degradation
    YALI0B10406g
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YALI0B10406g
   00310 Lysine degradation
    YALI0B10406g
   00380 Tryptophan metabolism
    YALI0B10406g
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YALI0B10406g
Enzymes [BR:yli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YALI0B10406g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:join(1427011..1427091,1427427..1428386)
Genome map
AA seq 346 aa AA seqDB search
MRSLYINVPGLFPSTSLARETVHHRTEMLRTIRSSSRLGVRAMSTAATRRAAQIGFHTRV
PTVVTKAPTLRMQTTPFSSSAPAQTFGDKKYEHILTSTPVPKVALVTLNRPKALNALCTP
LIKELNEALQAADADPTIGAIVLTGSEKSFAAGADIKEMKDKTVTSVLNENFIEEWGNMA
NIKKPIIAAVNGFALGGGCELAMMADIIYAGAKAKFGQPEIKLGVIPGAGGTQRLTRAIG
LYRANHYILTGEMFTAQQAADWGLAAKVYEPAQLVDESVKAAAQIASYGQLAVQAAKASV
HQSAEVGLRAGLEFERVRFHGLFGTHDQKEGMAAFAEKREPNFKNE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcctatatataaacgttccgggtctttttccttccacctctctagcacgagaa
acagtccaccacagaacagaaatgctccgaaccatccgatcttcctctcgacttggcgtc
cgagccatgtctaccgctgccacccgacgagctgcccagattggcttccacacccgagtc
cccactgtcgtcaccaaggcccccaccctccgaatgcagaccacccctttctcttcctct
gctcccgcccagacctttggtgacaagaagtacgagcacatcctgacctccacccccgtc
cccaaggtcgctctcgtcaccctcaaccggcccaaggccctcaacgccctgtgcactcct
ctcattaaggagctgaacgaggctctccaggctgctgatgccgaccccaccattggcgcc
atcgttctcaccggatccgagaagtcctttgctgccggcgccgacatcaaggagatgaag
gacaagaccgtcacttccgtgctcaacgagaacttcatcgaggagtggggcaacatggcc
aacatcaagaaacccatcattgctgccgtcaacggctttgccctcggtggtggatgcgag
cttgccatgatggccgacatcatctacgccggcgccaaggccaagtttggccagcccgag
atcaagcttggtgtcattcccggagctggaggaacccagcgactcacccgagccattggc
ctctaccgagctaaccactacattcttaccggagagatgttcactgctcagcaggctgct
gactggggtctggccgccaaggtctacgagcccgcccagctcgttgacgagtccgtcaag
gctgctgctcagatcgcctcttacggccagttggctgtccaggccgccaaggcttctgtc
caccagtccgctgaggtcggtctccgagccggtctcgagtttgagcgagtccgattccac
ggtctctttggcacccacgaccagaaggagggcatggctgcttttgccgagaagcgagag
cccaacttcaagaacgagtaa

DBGET integrated database retrieval system