KEGG   Yarrowia lipolytica: YALI0B10406gHelp
Entry
YALI0B10406g      CDS       T01033                                 

Definition
YALI0B10406p
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
yli  Yarrowia lipolytica
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:yli01200]
Metabolism; Overview; Fatty acid metabolism [PATH:yli01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:yli00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:yli00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:yli00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:yli00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:yli00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:yli00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:yli00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:yli00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:join(1427011..1427091,1427427..1428386)
Genome map
AA seq 346 aa AA seqDB search
MRSLYINVPGLFPSTSLARETVHHRTEMLRTIRSSSRLGVRAMSTAATRRAAQIGFHTRV
PTVVTKAPTLRMQTTPFSSSAPAQTFGDKKYEHILTSTPVPKVALVTLNRPKALNALCTP
LIKELNEALQAADADPTIGAIVLTGSEKSFAAGADIKEMKDKTVTSVLNENFIEEWGNMA
NIKKPIIAAVNGFALGGGCELAMMADIIYAGAKAKFGQPEIKLGVIPGAGGTQRLTRAIG
LYRANHYILTGEMFTAQQAADWGLAAKVYEPAQLVDESVKAAAQIASYGQLAVQAAKASV
HQSAEVGLRAGLEFERVRFHGLFGTHDQKEGMAAFAEKREPNFKNE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcctatatataaacgttccgggtctttttccttccacctctctagcacgagaa
acagtccaccacagaacagaaatgctccgaaccatccgatcttcctctcgacttggcgtc
cgagccatgtctaccgctgccacccgacgagctgcccagattggcttccacacccgagtc
cccactgtcgtcaccaaggcccccaccctccgaatgcagaccacccctttctcttcctct
gctcccgcccagacctttggtgacaagaagtacgagcacatcctgacctccacccccgtc
cccaaggtcgctctcgtcaccctcaaccggcccaaggccctcaacgccctgtgcactcct
ctcattaaggagctgaacgaggctctccaggctgctgatgccgaccccaccattggcgcc
atcgttctcaccggatccgagaagtcctttgctgccggcgccgacatcaaggagatgaag
gacaagaccgtcacttccgtgctcaacgagaacttcatcgaggagtggggcaacatggcc
aacatcaagaaacccatcattgctgccgtcaacggctttgccctcggtggtggatgcgag
cttgccatgatggccgacatcatctacgccggcgccaaggccaagtttggccagcccgag
atcaagcttggtgtcattcccggagctggaggaacccagcgactcacccgagccattggc
ctctaccgagctaaccactacattcttaccggagagatgttcactgctcagcaggctgct
gactggggtctggccgccaaggtctacgagcccgcccagctcgttgacgagtccgtcaag
gctgctgctcagatcgcctcttacggccagttggctgtccaggccgccaaggcttctgtc
caccagtccgctgaggtcggtctccgagccggtctcgagtttgagcgagtccgattccac
ggtctctttggcacccacgaccagaaggagggcatggctgcttttgccgagaagcgagag
cccaacttcaagaacgagtaa

DBGET integrated database retrieval system