KEGG   Yarrowia lipolytica: YALI0B11044gHelp
Entry
YALI0B11044g      CDS       T01033                                 

Definition
YALI0B11044p
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
yli  Yarrowia lipolytica
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YALI0B11044g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YALI0B11044g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:complement(join(1492016..1495994,1496102..1496406))
Genome map
AA seq 1427 aa AA seqDB search
MDSLHVSSTSVLVDVVEAVETATSLVVDTAEAVATEQATPTAVISNALARSAYAAHTSLS
YLAWAFGLWFLRLIGWVCYGIPTYVLGLLGRTINISLQFSSLLLILIALVTVVVAVVRYK
YLTVYSRLPQEQPRQEPEIDMYDESDNEDEKTGFANYFDEFLSAVKIFGYLERPVFHELT
RHMQTWKLSADEMVPLDDEQGFSVVVEGTVQVFAKQSSFVQNPTSVPDSRKEDSIMFNGE
RYTLLSEIKNGAPLTSLFNILSLFTDDLQLHKNFDSAVNSPMTSASDVPNMSLSSDGSDD
LQKGEPQFGEPRLSEKPAAKLSVTVRAATDSTIAIIPAAAFRRITKKFPQATAHIVQVIL
TRFQRVTFQTGHHYFGLTPEIFQTEVNLNSHARNELPGYLREGAVKKLNQVYDASQMGGR
PKKYTVTLNKKNKGKGSRRQRFSVQLNNQGHLNSQSRMVSLDSLEAVGDHMNPGDLLTNV
PLSRQGRPVFELSSVKHKASIQNLSFSGNDDENEDTALRTALVEAIFKVLGIDRDSIQSS
IMAVKTMSNTASPMFTGATTGGSSGSLGEELRSRRTGQDSLGASHFGVGLPSERSQNSFY
ARSETSTSSVDEDSLMAAPFDTIRNDVAQYMDVVLFKKDSLLIKQDDPTPGLYYLIDGVL
EVGYTDHHKIYHDLYTVQPGGVGGYIGSILGHRSFADLRARTDVYAGFLPRAAIERMSDK
YPMVHLTMAKSLTKVLSRLLLHLDFAMEWVQVRAGQKIYKEGQEADAIYIVLNGRVRSVA
ETKGDSGIVGGESGDAKDGKSHRKNLTSIGEYGKGESVGELEVLTLTRRPSTLVAIRDAE
LAKIPRALFESLALHYPSITFEISRIVASRVRTLMEDSAPIPRRMHTFDMAAHHDSYLTI
AVVPISQDVDVSEFGRRLYNGMQAVGREACHLNHASVLNHMGRHAFNPLGKLKLSGFLDD
IEDRYQTVLYVADTPPGSSWTHTCISQADCVLLVADARSEPDIGEYERVLVKMRTTARTE
MVLIHPERYVPPGLTSAWLKPRVWVHTHHHVQMDLPRHEADVLASIRKMKRTGTLANLKN
KVQTIQEEFRSMYRPKANIYSTSSANKDDFNRLARILSGQAIGLVLGGGGARGISHIGII
KALEDSGIPIDFVGGTSIGSFIGGLYAKEYDLVPIYGRAKKFSGRVSSLWRMALDLTYPA
TSYTTGHEFNRGIWKAFGDSRIEDFWLRYFTNTTNITHSRMEIHTSGYAWRYIRASMSLA
GLLPPLTDNGSMLLDGGYVDNLPVSEMKAQGASVVFAVDVGSIDDTTPMNYGDSLSGAWV
MWNRWNPFGRHPNVPNLAEIQARLAYVSSVGALEKAKHTPGVIYMRPPIDDFATLDFAKF
LDIYRVGNKYGHKFLTELREDGKFPAIPGMENVKTKHKRTIARRNSI
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
atggactctttgcatgtctcttcgacaagtgttctggtcgacgtcgtggaagctgtggaa
accgctacctcactggtagtggacacagctgaagccgttgcaacagaacaagctactcca
acagcagtcataagcaatgctctagcccgaagtgcctatgcggcacatacgtcattgtca
tatttggcatgggcttttggcttgtggtttctgcgacttattggatgggtctgctatggt
attcctacctacgttctagggctgctaggtagaaccatcaacatttctcttcagttttct
tctttactactcattctgattgccttggtcaccgtggtggtcgcggtggtacgatacaag
tatctgaccgtgtactcccgtcttccccaggaacagcctcgacaggagcccgagatcgac
atgtacgacgagtccgacaacgaggacgaaaagacgggcttcgctaactactttgacgag
tttctgtcagccgttaagatctttggatacctggaaagacccgtgttccacgagcttaca
cgccatatgcagacgtggaaactctctgccgacgaaatggtgcctctagatgatgaacag
ggcttctcagttgtggtggaaggaactgtacaggtctttgccaaacaatccagttttgtg
caaaacccaactagcgtgcctgactcgagaaaggaagactcaatcatgttcaacggagaa
cgatacaccctgctttccgagataaaaaatggagctccccttacttcgctgtttaacatt
ctttctctgttcactgacgatctgcagcttcataagaatttcgacagtgctgtcaactcg
cccatgacgtccgcctccgatgtccccaacatgtctttgtcttctgacggctctgacgat
cttcagaagggagaacctcagtttggagagccccgattgtctgagaagcctgctgccaaa
ctatcagtgacagtcagagcagctactgattcaaccatcgccatcatcccagctgctgcg
ttccgacgaatcaccaaaaagtttccccaggccactgctcatattgttcaggtaattcta
actcgtttccagcgagttacattccagactggtcatcattactttggcttgacccctgaa
atctttcaaaccgaagtgaatctaaacagtcatgcccgaaatgaactccctgggtatctc
cgggaaggagctgtcaagaagctgaaccaggtgtacgatgcttctcagatgggtggccgt
cccaaaaagtacaccgttactctcaacaagaagaacaagggcaaaggcagcagacgtcag
agattctctgtgcagctcaacaaccagggtcatctcaacagtcagagtcgaatggtaagt
ttggactcgttggaagcagttggggatcacatgaatcccggcgatctgctgaccaatgtg
cctttgtcacgacagggacggcctgtgtttgaactatccagtgtgaagcacaaggctagt
attcagaacctgtccttcagtggaaacgatgatgaaaacgaggacactgccttgcgtacg
gcccttgtggaagctattttcaaggtccttggaatcgaccgtgattccattcagtcttcc
atcatggccgtgaagactatgtccaatacagcctcccctatgttcacgggagccaccact
ggaggaagcagtggatctctaggggaggaactccgaagccgacgaactggtcaagattct
ctgggggcatctcactttggcgtcggtctaccttctgagcggtcccagaattcgttctac
gctcgatctgaaacctctacttccagtgtagacgaagactcacttatggctgcccccttt
gatacaatccgaaacgatgtagcccagtacatggacgttgttttgttcaagaaagactct
ctcctcatcaagcaggatgaccccactcctggattgtactacctgattgatggtgttctt
gaggtcggatacacagatcatcacaagatttaccatgatctatacactgttcagcctggt
ggggttggtggatatattggctctattctcggacaccgatccttcgccgatctgcgcgcc
cgaacagacgtctatgccggcttccttcctcgagccgcaatcgagcgcatgtctgacaag
taccccatggtccatctaaccatggcaaagtctctgactaaggtactgtctcgtctttta
ctgcatcttgatttcgctatggagtgggtacaggttcgagctggacagaaaatctacaag
gagggtcaggaagcggatgccatctacattgtcttgaacggccgagtgcgttctgtggct
gaaactaagggcgactccggtattgtgggaggtgaatctggtgatgcgaaggatggaaag
agtcatcgaaagaatctcaccagtatcggagaatatggaaagggcgagtctgttggcgag
ctggaggtgttaacacttaccagacgtccctctactctcgttgccattcgagatgctgag
ctggccaaaattcccagagctctgtttgagtctttggccctccactaccccagtatcacc
tttgagatctcccgaattgtggcttcacgagtccgtactctaatggaagactccgctccg
attccccgacgaatgcacacctttgatatggctgcccaccatgatagttacttgactatc
gctgttgttcccatctctcaggatgttgatgtgagtgagtttggacgacgactttacaac
ggtatgcaggcggtgggacgagaagcgtgtcacttgaaccatgcttctgtgcttaaccat
atgggcagacatgctttcaaccctcttggtaagttgaagctgtctggtttccttgatgac
attgaggaccggtaccagactgttttgtatgttgcagatacccctcctggttcctcatgg
acccatacttgcatttctcaggctgattgtgttctgcttgtcgctgacgctcgttccgag
cctgacattggtgagtacgaacgtgtgctggtgaagatgcgaaccactgccagaaccgag
atggttctcattcaccctgaacgatacgttcctcctggactcactagtgcgtggttgaag
cctcgagtgtgggttcacacccatcatcacgttcagatggatcttcctcgtcatgaagct
gatgtcctggccagtatccgaaagatgaagcgaacaggaaccctcgcgaacctcaaaaac
aaggtccaaacgatccaagaagagttccgttccatgtaccgccccaaggctaacatctat
agcacgtcttcggccaacaaggacgacttcaatcgacttgccagaatcctctctggacaa
gctattggacttgttcttggcggaggaggagctcgaggtatttcccatattggaattatc
aaggctctcgaagactctggtattcctattgatttcgtgggaggtacttccatcggttcc
ttcataggggggctctatgccaaagaatacgatctggtgcccatctatggacgagccaag
aagttctctggacgagtatcttctctttggcgtatggctttggatctgacctatcctgcc
acctcatacaccactggtcacgagttcaaccgaggaatctggaaagcttttggcgactcc
cgtatcgaagacttctggctccgatacttcactaacacgacaaacattactcattctaga
atggagatccacacatctggatatgcgtggagatacattcgagcaagtatgtctcttgct
ggtcttcttcctcctttgacagacaatggatctatgttgttggatggaggttatgttgat
aacctgcctgtttcggagatgaaggctcagggagcctccgtggtatttgccgtagatgtc
ggatctatcgacgataccactcccatgaactacggtgactccttgtctggtgcatgggtc
atgtggaaccgatggaatccctttggtcgacatcctaatgttcccaacctggcagaaatt
caggctcggttggcatacgtatcatcagtgggtgctcttgagaaggctaagcacacccct
ggcgtcatctacatgcgtccccccattgacgattttgctactcttgacttcgccaaattc
cttgacatctatagggtaggtaacaagtacggccacaagttcctgaccgagttgcgagag
gatggcaagtttcctgctatccctggaatggagaatgttaagaccaaacataagagaacc
attgcccggcgaaatagtatttag

DBGET integrated database retrieval system