KEGG   Yarrowia lipolytica: YALI0B11154gHelp
Entry
YALI0B11154g      CDS       T01033                                 

Definition
YALI0B11154p
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
yli  Yarrowia lipolytica
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:yli00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
Position
B:join(1505279..1505342,1505416..1505457,1505537..1506864)
Genome map
AA seq 477 aa AA seqDB search
MSNRDLLPQLASLGANGLIVPATKFKQSRTCASLFETRPEKIEIAYENILFAEPSEKDET
SIKISYGDVSKTSCIPKTVVAAFDGGDPAAVADEIMQKAYGAAKPKKRFLILVNPNGGTG
HAARVFKYASEPLLRAANCSLNVVETTHRYHAQEIGAEIPMDKYDAIMCCSGDGIPHEVI
NGMASRPEDGAQLLQSVAICQLPCGSGNSLSWSLNGTSSASIATLKMIKGRAIPVDYMAV
TQGDKRVVSFLSQAWGLVADLDLGTEHLRWMGGARFTVGAIARIINRKAYPCEIAVKVHT
RDVRELSKHYQKYIVDRVDPLSSEEIAKLDPNVFASLKYGSVNDPIPSDWEVSTSKEMAN
FYTGKMPWVSADSLAFPAAIPHDGLIDVMTWDGKVGRSDAVNLLVASETGRHIDLPVAGY
MKIEAFRITPIGKSDYISIDGESFPIEPYQVEVLPRAGLYLAHEGTYIRSGFPFKKY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccgcgatctcttgccccagttggcaagcttgggggcaaatggactgatagtg
cctgccaccaaattcaaacagtctcggacttgcgcttctctctttgaaacgcgcccagaa
aagatagaaatcgcatacgagaacatcttgttcgccgagccgtccgaaaaagacgaaacc
tccatcaaaatcagctatggagacgtgtctaaaacttcttgcattccgaaaaccgtcgta
gcagctttcgatggaggagaccccgctgccgtggccgatgaaattatgcagaaggcctac
ggagcagccaagccgaaaaaacggttcctgatcctcgtcaatcccaatggaggaactgga
cacgcagcaagagtgttcaagtacgcctctgaacctcttctccgggcagcaaactgttcc
ttgaacgttgtggaaactactcaccggtaccatgcccaggagattggtgcagaaattcct
atggacaaatacgatgctatcatgtgttgttctggagacggtatcccacacgaggtcatc
aatggtatggcctcccgtcccgaagacggagcccagctgctgcaatccgtggctatctgt
cagctgccctgtggatcgggaaactcgctgtcgtggtcgctaaatggcacttcttctgcg
tctatcgcaacattgaaaatgatcaagggaagagccattcccgtggactatatggctgta
acccagggcgacaagcgcgtcgtttcgttcctctcgcaggcgtggggactggtggcggac
ctggaccttggaactgagcatctgcgatggatgggaggagcacggttcacagtcggagct
attgcacgaatcatcaaccgaaaagcctacccgtgtgaaatagcagtcaaagtacacacc
cgagatgtacgcgagctcagcaaacactaccaaaaatacattgtggaccgagtggatcct
ctcagtagtgaggagattgccaagctcgaccccaacgtgtttgcttcgctcaaatatggc
tctgtcaacgacccgattccttctgactgggaagtctcgacatccaaggaaatggcaaac
ttctataccggtaagatgccctgggtgtctgcggactctttggcattccctgctgccatc
cctcatgatggccttatcgacgtcatgacatgggacggcaaggttggtcgaagtgacgct
gtcaatctgctggttgcctcggaaactggccgtcatatcgacctgcccgttgcgggatac
atgaaaatcgaggcattccgaatcacgcctattggaaagtcggactatattagtattgac
ggagagagctttcccattgagccataccaggtcgaagttctccccagagcagggctctat
ctggcccacgagggcacatatattcgatctggcttccccttcaagaagtattag

DBGET integrated database retrieval system