KEGG   Yarrowia lipolytica: YALI0B12628gHelp
Entry
YALI0B12628g      CDS       T01033                                 

Definition
YALI0B12628p
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     YALI0B12628g
Transfer RNA biogenesis [BR:yli03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    YALI0B12628g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:complement(1689693..1691354)
Genome map
AA seq 553 aa AA seqDB search
MAHKNKGKQLAPEHERFLSACTDIALELVGSLSNGSTKDINLNALVTKYAKQYKLASQPR
LTDIIGSIPDQYKKYLLPKLQAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGP
DSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVDQLRSLGHSVDKVEYIIMGGTFMS
LDKEYREGFISQLHNALSGVHAEDVDEAVRLAQHSNTKCVGITIETRPDYCTETHLSDML
RYGCTRLEIGVQSVYEDVARDSNRGHTVKAVCHTFALAKDAGYKVVSHMMPDLPNVGMER
DLDQFREYFSSPDFRTDGLKLYPTLVIRGTGLYELWKTGRYKSYNANALIDLVARILALV
PPWTRIYRVQRDIPMPLVTAGVENGNLRELALARMKDFGTKCRDIRTREVGIQEVHHRVR
PDQVELIRRDYTANGGWETFLSYEDPEQDILIGLLRLRLCSEKTTYRPELTGQKTSLVRE
LHVYGSAVPLHNRDPRKFQHQGFGTLLMEEAERIAREEHGSKKISVISGVGVRNYYAKLG
YFLDGPYMSKWLD
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggctcacaaaaacaagggcaagcaacttgctcctgagcacgagagatttctatctgcg
tgcactgatatcgcgctggaactcgttggatcgctgtccaacggatccaccaaagatatc
aacctcaacgctctggtgaccaagtatgctaagcaatacaagctggcctcccaacctcgt
ctgacagacattatcggctccattcccgatcaatacaagaaatacctgctaccaaaacta
caagccaagcctgttcgaactgcgtccggtattgcagtggtggctgtcatgtgcaagcct
cacagatgtcctcatatcgcttacactggtaacatttgcgtctattgccccggaggtccc
gattccgactttgaatactcaactcagagttatactggatacgaacccacgtccatgaga
gctatcagagctcgatacgatccctatgagcaggcacgaggtcgagtggaccagctgcga
tctctgggtcactctgtcgacaaggtggagtacattatcatgggaggaactttcatgtct
ctggacaaggaatatagagagggatttatttcacagctacacaacgctctatctggagtt
catgcggaggacgtggatgaagctgttcgtctggctcagcattctaacacaaagtgtgtc
ggcatcaccatcgaaacacgtcctgattactgcactgaaacacatctgtcggacatgttg
agatacggctgcacgcgtctggaaattggagtccagagtgtgtacgaggatgttgctcga
gactctaaccgaggacacaccgtcaaggctgtctgccacacctttgcattggccaaggac
gctggatacaaggtggtttcgcacatgatgcccgatcttccaaatgtgggcatggagcga
gacctcgaccaattccgggagtacttttcgtcgcccgatttccgaactgacggtctcaag
ctatatcccactctggtaatccgaggtactggtctatacgagctgtggaagactggtcgg
tacaagtcctataatgccaacgctctgattgatctggtggctcgaattcttgcattggtc
ccgccgtggacccgaatctaccgagtgcagagagatatccctatgccgttggtgacagct
ggtgtggagaacggaaatctacgagaactggcgctggcacgaatgaaggacttcggaaca
aagtgtcgagatattcgaactcgagaggtaggtatacaggaggtgcatcatcgagttcga
cctgaccaggtggaactaatccgccgagactatacagccaacgggggatgggagactttc
ttatcctacgaagatcccgagcaggacatcctcattggtctgcttcgattgcgactgtgt
tccgaaaagaccacctaccgaccggagctgactggccagaagacttctctggttcgagag
ttgcatgtctatggttctgccgtgcctctgcacaaccgagaccctcgaaagttccagcac
caaggttttggtacgctgctgatggaggaggctgagcgcattgctcgtgaagagcacggc
tccaagaagatttctgtcatttccggtgtgggagtgcgaaactattacgccaagctgggc
tacttccttgatggtccgtacatgagcaagtggctggattag

DBGET integrated database retrieval system