KEGG   Yarrowia lipolytica: YALI0B13178gHelp
Entry
YALI0B13178g      CDS       T01033                                 

Definition
(RefSeq) YALI0B13178p
  KO
K08294  mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
yli  Yarrowia lipolytica
Pathway
yli04011  MAPK signaling pathway - yeast
yli04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:yli00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YALI0B13178g
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    YALI0B13178g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     YALI0B13178g
Protein kinases [BR:yli01001]
 Serine/threonine kinases: STE group
  STE7 family
   YALI0B13178g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Seadorna_VP7 Kdo Haspin_kinase FTA2 YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 2907533
NCBI-ProteinID: XP_500830
UniProt: Q6CET2
Position
B:join(1774284..1774335,1774493..1776009)
Genome map
AA seq 522 aa AA seqDB search
MYLENLKRQESLGHVISNRTFGTRTRTQTLRHSNPLKLTHSLITPRDTLSHVHHCLEADT
RRPAETQTQTAKKKKLPYHMSAPPLLPPKRPVGARMKLPVLQIPTTSTESPSDQQRPQRP
SLMLNTGNGNNGNNNGSAHNTHVVDSNLEPPSMLGNNRSVSPQSAAFSAEILAAVGSPAP
DKHVTHEYPVHPSSHSNNSGDDDGMDETQDLTGLDVDDLDEEKWHSVARTGGIVELGKLG
EGAGGSVTLCRLRTGSTVFALKSITANPNPELQKQIVRELRFNRTCSSPHIVKYYGTFLN
DEAASIFIAMEYCGGGSLDAIYKRVKDRGGRIGEKVLGKVAEGVLKGLSYLHERRIIHRD
IKPQNILLDKEGQVKLCDFGVSGEVVNSLATTFTGTSYYMAPERILGQPYSVTSDVWSLG
LTIMEVAQHRFPFISAEQEAREEPITPIELLSIIVNAPAPELKDEPEEGIKWSNAFRHFL
LCCLEKDQSKRASPRQMLKHPWMLGQMQKQVKMDKFVKEVWN
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtatttggagaatttgaagaggcaggagagtctaggtcacgtgattagcaacaggacg
tttggcactcgcacacgcactcaaacactccgacactctaaccctctaaagctcacacac
tcactaataacgccacgagacactctgtcccacgtccatcactgtctggaagccgatacg
aggaggccagcagaaacacagacacaaacagctaaaaagaaaaaactgccatatcacatg
agtgcaccgccattattgcctccaaaacgccccgtgggagcgcgcatgaaactgccagtt
ctccagatccccaccacctccacagagtcgccatccgaccagcagcggccacagcggccg
tccctgatgctcaatacgggtaacggtaacaacggaaacaacaacggatctgcccataac
acccatgttgtggactctaatctggaacctccatccatgctgggcaacaaccggtctgtg
tctccgcagtcggcagccttcagcgcagaaattctcgcggccgtgggctcaccggcaccg
gacaagcacgtaacccacgagtaccctgtgcacccttcgtctcactcaaacaactctggt
gacgacgatggcatggacgagacccaagatctcaccggtctcgacgtggatgatctggac
gaggaaaagtggcactcggtggcgcgcacgggaggcattgtagagctgggtaaactgggt
gagggcgcaggtggatccgtgacgctgtgtcgacttcgaacgggctccaccgtcttcgcg
ctcaagagcatcaccgccaaccccaaccccgagctgcagaagcagattgtgcgtgagctg
cgcttcaaccgaacttgctcgtcgccacacattgtcaagtattacggcacgttcctcaac
gacgaggcagcctccatcttcatcgccatggagtactgtggaggaggatccctggatgcc
atctacaagcgggtaaaggaccggggaggacgaatcggagaaaaagtgctgggaaaggtg
gccgagggtgtgctgaagggtctttcatacctgcacgaacgacgcatcattcacagagac
atcaagccccagaacattcttctggataaggaaggtcaggtcaagctatgcgactttggt
gtatctggagaagtggtgaactcgctggccactaccttcacaggtacctcttactatatg
gctcctgagagaatcctgggccagccctactctgtcacctccgacgtgtggtcacttgga
ctcaccattatggaggtggcccagcatcggttcccgttcatctctgcagaacaggaggct
cgagaagagcccatcacgccaatcgagctgctgtcgattattgttaacgctcctgctccc
gagctgaaggatgagcctgaggagggcatcaagtggtccaatgcatttagacactttctg
ttgtgctgcttggagaaggaccagagcaagcgggcgtcgccccggcagatgctcaagcac
ccctggatgctcggtcagatgcagaagcaggtcaagatggacaagtttgtcaaggaggtg
tggaactag

DBGET integrated database retrieval system