KEGG   Yarrowia lipolytica: YALI0B14597gHelp
Entry
YALI0B14597g      CDS       T01033                                 

Definition
YALI0B14597p
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
yli  Yarrowia lipolytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:complement(1938611..1942960)
Genome map
AA seq 1449 aa AA seqDB search
MDLQVVSHICAFYLFHHLCTSGNAMYTHENNSVPELSLDRDSVQTNAQSPTSNGSSSKIH
VLNDILTSPAILPSVILKQECSRSQSPEGYALQRSIKQLPPVPSYRVPQFDEATSQPVGS
SHLQHMRQSRHECEGHWEANNNCANLNDAPNRTTPITTTTPTARIGDHETTSSSPPLTAR
SSVVHSRIASLIHTPQVIEGWSITTPSEADTPEVYSSPHFPLDSLTEHLRLYSNNTTTAT
MDHVADSHHAADLSAEQQLELQLPPAIQDLLYQPHNATMAQRTFIIALLWQKWPQFRASP
VAGEEVVLFKKGLLDNFASAVGIIGDDVEAEFNVLPPDQDFMPPDQLDQTDICDPHTMRL
KPGFTGDDFDTVPVRFYSLLDEWRLLDTDSPVIKRFYIADPPRLELYPPEFTLAQLRQKR
TLDWESGDRQSRLPTIQVSEIELSRLNQEISDQLDIRGDLRVYATSEALDGPVDLATFKR
MQKVRLQSPYTTDKLTPNLIISAKEARGYIEDSLTAGPTMGTTGLSNLGNTCYMNSALQC
LVHVPEVVEYFLSGYYESEINKDNPIGKNGDVALAFAELVRRVYLDKSSTYAPRQFKSIV
GEYGPQFAGYGQQDSQEFLAYLLDSLHEDLNRILQKPATTKPELDPERAGDPLEVARVAV
ESWDVHRLRNDSPILDLFTGMYKSTVVCPVSQQASITFDPFSDLTLPLPVDDSWSKDFIF
VPYDTSQQPCIIPIELKKHSRFQELRQLVASKAGENVNPESLMFSEVYMSQFFRHISRDE
TSSVSELIPGNDTVVVYETGLSADEMWSYHHDLEPAKFIVPVFNRLEYTDTEEQPLSSYA
RRNSQFLSIPFFITVTDGEARDFSLVTNLIYKRYFQLCRSVEEWAVLEELAFDVNYVTPR
TNDIPLGGLSMLNADRIFPMSSRLDASESSEPDVIEIDASLNTPDKEDVKMEDENEGDQA
EVETAAEEAAEEDVTEPPVVAEEPAAIESVVDISDDEAYKSLVESTGSSVTPSESNCSEL
PDAVDSGATAVVAAPSVDGHASLPSPPAPSHFVTHTEGIVCDWQGDTAAKYLHDYDSLAT
SLETKVDPKLEAVRAARADKSNQGIDLSECLDLFSASEVLSDDDLWYCPVCKDFRQATKK
IELWKCPEILVIHLKRFSSSRNFRDKISEVVHFPIEGLDLTERVGEAKASDSPLIYDLIG
VDNHMGGLGGGHYTAFAKNFVDGKWYHYNDSSVSPISENQLVTANAYLLFYKRRIPTASG
DATDTKTHEILRDLVAKRGENDLSVYSSFVASVEGKLVGGSSSNTRSSGGSGGGSTSSAS
SYSSGSSSGPFGSSSSSVAPRLKFRGNMVVSPESPLGNPPAYPGSGSVLGPSPQSSADAT
EPPSSVGGIPWEAASLTLSSSDEEDNMASDLPTPGDSDMHSSVYSEPKVVDTEEGREEKD
DEVIIIDDI
NT seq 4350 nt NT seq  +upstreamnt  +downstreamnt
atggacttacaagtggtctctcatatatgtgctttttatctctttcaccatctctgcacc
agcgggaatgctatgtacacccacgaaaacaactctgtgcccgagctctctctcgaccgc
gactctgttcaaaccaacgcccagtctccaacctccaatggtagcagttccaagattcat
gtcctgaacgacattctgacatcaccggccattctccccagtgtcattttgaagcaggaa
tgtagccggtcccagagccccgagggatacgcgctacaacgcagtataaagcagctgcct
ccagtgcccagctacagggttcctcagtttgacgaggccacatcccagcccgttgggagt
tcccacctgcagcacatgaggcaatcgagacacgaatgtgagggtcactgggaggctaac
aataattgtgccaatttaaacgacgccccaaacagaacaacgccaatcaccaccacaaca
ccaacagcacgtattggagaccacgaaaccaccagctcatcaccccccttaacagcacgc
agctctgtggtacattcacgaatcgcatctctcatccacacgccccaggtcatagaggga
tggtcaatcacaacaccatcagaagcagatacacccgaagtttattcgtcgccacacttc
ccgctagactcgctgacagagcatctgcgattatacagtaataataccaccacggcgacc
atggatcacgtggcggactcccaccacgcggcggacctctctgcagagcaacagttggag
ctccagttgcctcctgcgatccaggacttgctataccagccccacaatgccaccatggcc
caacgcaccttcatcattgccctgctgtggcaaaagtggccccagttccgcgcctccccc
gtggcgggagaggaggtggttctgttcaagaagggccttctcgacaactttgccagcgct
gtggggatcatcggagacgacgtggaggccgaattcaatgtcctaccgcccgaccaggac
ttcatgcctccagatcaactcgatcagacagatatatgcgacccccataccatgcggctc
aagccggggttcaccggagatgactttgacacagtaccggtgcgcttctatagcctgctg
gacgagtggcgtttgcttgacacagactcacctgtgattaagcgattctacatcgctgat
ccgccccgtctggagctctacccgcctgaattcacactggctcagttgcgccagaaacgc
accctggattgggaatcaggagaccggcaatcgcgtctgcctacaattcaggtgtcggag
attgagctgtcgcgtctgaatcaagaaatctccgaccagctcgacatcagaggtgatctg
cgagtctacgccacatctgaagcgctggacggacccgttgatctcgctaccttcaagcgc
atgcaaaaggtgcgtcttcagagcccttacacaaccgataaactgactcctaacctgatc
atctcagcaaaggaggcccgtggatatattgaggacagtctcacggctggacccacaatg
ggtaccaccggtctcagcaacctcggtaacacatgctacatgaactcagcgctacagtgt
ctggttcatgtacctgaggttgtggagtacttcttgtcgggctattacgagtccgaaatc
aacaaggacaacccgattggtaagaacggtgatgtggccttggcatttgctgaacttgtg
cgacgtgtctatctcgacaagtcaagcacatatgctcctcggcagttcaagtccattgta
ggagagtacgggccccagtttgctggctacgggcagcaggactcgcaagagttcctcgcc
tacctgctggactcactgcatgaagatctcaaccgaattcttcaaaaaccagccactaca
aagcccgagctggaccctgagcgggctggagatcccttggaggtggctcgagtggctgtg
gagtcgtgggatgtgcatcgattgcgaaatgattcgccaatcctcgacctgttcactggc
atgtacaagtcgacggttgtatgccctgtctcacagcaggcctcgattacctttgacccc
ttctcagatctcactttgcctcttccggtggacgactcgtggtcgaaggatttcattttt
gtaccttatgacacctcccaacagccgtgcattattcctattgagctgaagaagcactct
cggttccaggagcttcggcagttggtggcatcaaaggccggtgagaatgtaaacccagaa
tctctcatgttctctgaggtgtacatgtcgcagttcttcagacacatttccagggatgaa
accagctccgtttccgaacttattcctgggaacgacacagtggtggtgtatgagacgggt
ctttctgccgacgaaatgtggtcgtatcatcacgatctggagccagcgaagttcattgtt
ccggttttcaatcggctggaatacactgacacggaagagcagcccctgtcttcctatgct
cggcgtaactcccagtttctgtcgattccgttcttcatcactgtcacagacggagaggct
cgtgactttagcttagtcaccaatctcatctacaagcggtacttccaactttgtcgaagt
gttgaggagtgggctgtgttggaggaactcgcttttgatgtcaactatgtgactccccga
accaacgatatccctctgggcggattgtcgatgctcaacgctgatcgaatcttccccatg
tcgtcccgtcttgatgccagcgagtcttctgagcctgacgtgattgagattgacgctagt
ctgaacaccccagacaaggaggatgtcaagatggaggacgagaatgaaggagaccaggca
gaagtggagactgctgctgaagaagcagctgaggaagatgtgactgagcctccagttgtg
gctgaggagcctgctgctattgagagtgtggtggatatctctgatgacgaggcttacaag
tctctggttgagtctactggttcttctgtgactccttctgagtcgaactgttcggaactg
cccgatgctgttgatagtggtgcgactgcagtggttgcagcaccctccgttgacggacat
gcttctctaccctctcctcccgctcctagccattttgtcacccatactgaaggtattgtt
tgtgattggcaaggagacacggctgccaaataccttcatgactacgactctctggccact
tctcttgaaactaaggttgatccaaagttggaggctgtcagagctgctcgagcagataaa
tctaatcaaggtattgatctcagtgagtgtttggatctcttttctgcctctgaggtactc
tccgatgatgatctttggtactgtcctgtttgcaaggacttccgacaggctaccaagaaa
attgagctgtggaagtgccctgagattctggtgattcatctcaaacggttttcaagcagc
agaaacttccgagacaagatctctgaggtggttcatttccctattgagggtctggatcta
actgagcgagttggagaggccaaggcttcggactctcccctcatctatgatcttattgga
gttgacaaccacatggggggtctaggaggtggacattacactgcttttgccaaaaacttt
gtcgatggtaagtggtaccattacaacgatagcagtgtgtctcctatttccgagaaccag
ctggttacagccaatgcctatctgttgttctacaagcgtcgaattcctactgcctctggt
gatgcaactgacacaaagactcacgagattcttcgagatcttgttgccaagcgcggtgag
aacgacctgtctgtctactcgtcgttcgtggcctctgtcgagggcaagctcgtcgggggt
agcagctccaacacgcgtagtagcggcggcagtggtggtggctctactagcagtgcgtcc
agttactcttctggctcgtcctcgggaccctttggtagcagcagcagctctgttgctcct
cggctcaagtttcgtggtaacatggttgtgtctcctgagtctcccttgggcaaccctccg
gcctaccctggctccggatctgttttgggcccgtctcctcagagctctgcggatgccacc
gagcctccgtcgtctgtgggcgggatcccatgggaggcggcttcgctgacactgtcgtca
tcggatgaggaggacaacatggcttcagatttgccaactcctggagattcagatatgcat
tccagtgtttattctgagccaaaggtggttgacacggaggaaggaagagaagagaaggac
gacgaggtgataattattgatgatatttag

DBGET integrated database retrieval system