KEGG   Yarrowia lipolytica: YALI0B14729gHelp
Entry
YALI0B14729g      CDS       T01033                                 

Definition
YALI0B14729p
Orthology
K10524  
nicotinamide/nicotinate riboside kinase [EC:2.7.1.22 2.7.1.173]
Organism
yli  Yarrowia lipolytica
Pathway
Nicotinate and nicotinamide metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:yli00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:join(1957298..1957399,1957460..1958122)
Genome map
AA seq 254 aa AA seqDB search
MIRRKIAEKKLAKEEDKREVTLVALSGPSSSGKSTLARLLRDILPHVIIIHQDDFYLEDS
QIPVIDGVQDWDCPEAFDFKLLSKVLSHVKQTGELPKNFKSKEDQNSLGPAALDENAVDA
FKRRMHPYMPEFENKLIVILDGIMVYHDAQFTELFDIKILVRSSYENLKSRREARSGYVT
LEGFWKDPEGYFHNIVWPGYLKTHKQLFENENPNGEPSKDATREGIRIVPTTDFDVAETL
DWVFDVILDYYDLE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgatccgacgaaaaatagctgagaaaaaactggccaaggaggaggataagcgcgaggtc
actttggtggcactcagtggcccctcgtccagtggaaagagtactctagctcgtctgctt
cgagacattcttccccacgtcatcatcatccaccaagacgacttttacctggaggactcg
cagatcccagttattgatggagttcaagattgggattgtcccgaggcttttgatttcaag
ctactgtccaaggttttgagccatgtcaagcagactggagagctgcccaaaaatttcaaa
tcgaaggaggaccagaactccctgggacccgctgctcttgatgaaaacgctgtcgacgcc
tttaagcgtcgaatgcacccttacatgcctgagtttgagaacaagctgattgtcattctg
gatggtatcatggtctaccatgacgctcaattcaccgagttgttcgatatcaagattctg
gtcagatccagttacgaaaacctcaagtctcgacgagaagctcgatccggatacgtcact
ctggaagggttttggaaggatcctgagggatacttccacaacattgtttggcccggttac
ctaaagacccacaaacagctgtttgaaaacgaaaatcccaacggagaacccagtaaggac
gccaccagagaaggaatccgaatcgtgcccaccaccgatttcgacgtggccgagactctt
gattgggtgtttgatgtcattctggactattacgatcttgagtaa

DBGET integrated database retrieval system