KEGG   Yarrowia lipolytica: YALI0B14729gHelp
Entry
YALI0B14729g      CDS       T01033                                 

Definition
YALI0B14729p
Orthology
K10524  
nicotinamide/nicotinate riboside kinase [EC:2.7.1.22 2.7.1.173]
Organism
yli  Yarrowia lipolytica
Pathway
Nicotinate and nicotinamide metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YALI0B14729g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     YALI0B14729g
    2.7.1.173  nicotinate riboside kinase
     YALI0B14729g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:join(1957298..1957399,1957460..1958122)
Genome map
AA seq 254 aa AA seqDB search
MIRRKIAEKKLAKEEDKREVTLVALSGPSSSGKSTLARLLRDILPHVIIIHQDDFYLEDS
QIPVIDGVQDWDCPEAFDFKLLSKVLSHVKQTGELPKNFKSKEDQNSLGPAALDENAVDA
FKRRMHPYMPEFENKLIVILDGIMVYHDAQFTELFDIKILVRSSYENLKSRREARSGYVT
LEGFWKDPEGYFHNIVWPGYLKTHKQLFENENPNGEPSKDATREGIRIVPTTDFDVAETL
DWVFDVILDYYDLE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgatccgacgaaaaatagctgagaaaaaactggccaaggaggaggataagcgcgaggtc
actttggtggcactcagtggcccctcgtccagtggaaagagtactctagctcgtctgctt
cgagacattcttccccacgtcatcatcatccaccaagacgacttttacctggaggactcg
cagatcccagttattgatggagttcaagattgggattgtcccgaggcttttgatttcaag
ctactgtccaaggttttgagccatgtcaagcagactggagagctgcccaaaaatttcaaa
tcgaaggaggaccagaactccctgggacccgctgctcttgatgaaaacgctgtcgacgcc
tttaagcgtcgaatgcacccttacatgcctgagtttgagaacaagctgattgtcattctg
gatggtatcatggtctaccatgacgctcaattcaccgagttgttcgatatcaagattctg
gtcagatccagttacgaaaacctcaagtctcgacgagaagctcgatccggatacgtcact
ctggaagggttttggaaggatcctgagggatacttccacaacattgtttggcccggttac
ctaaagacccacaaacagctgtttgaaaacgaaaatcccaacggagaacccagtaaggac
gccaccagagaaggaatccgaatcgtgcccaccaccgatttcgacgtggccgagactctt
gattgggtgtttgatgtcattctggactattacgatcttgagtaa

DBGET integrated database retrieval system