KEGG   Yarrowia lipolytica: YALI0B14927gHelp
Entry
YALI0B14927g      CDS       T01033                                 

Definition
YALI0B14927p
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
yli  Yarrowia lipolytica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YALI0B14927g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YALI0B14927g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:1980071..1981006
Genome map
AA seq 311 aa AA seqDB search
MQITIVGSLNYDLVTISNRLPNAGETMFSQGFETHCGGKGANQALATARLSSKVPDVNVK
MYGKVGKDNFGTQLKNNLKDSGVDVSAIHELDTKSGVAVIFVDQDSGENRIMVYAGANGE
WTEADLTDDLFDTDMLIFQNEIPIDIVYKAIEKAGSKKPKVVYNPSPVDERGNIPAAVLN
SIDFLVVNVTEATLISGVEINEEASKEEIWKQADQAADTLFKMGIKEAVVVTLGGNGVIY
KTKTDSGHVPSNKVEKIVDTTGAGDTFLGGFSTSIIQGKTVSEAIAFGNKAGGIAVTRRG
AAEGIPYDHEL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcacaattgtcggctcgctcaactacgatcttgtcaccatctccaacagactc
cccaacgctggggagaccatgttctcccagggctttgagacccactgcggaggtaaggga
gccaaccaggctcttgctactgccagactctcttccaaggtccctgatgtgaacgtcaag
atgtacggaaaggtcggcaaagacaacttcggtactcagttgaaaaacaacctcaaggat
tctggcgtggacgtgtctgccatccacgagctcgacaccaagtctggagtggctgtcatc
tttgtggatcaagactctggagagaaccgaatcatggtctacgccggagccaacggcgag
tggactgaggccgatctcactgacgatctcttcgacacagacatgctcatcttccagaac
gagatccccatcgacatcgtctacaaggccatcgagaaggctggatctaagaagcccaaa
gtggtctacaaccccagtcctgtggacgagcgaggtaacatccccgccgccgttctcaac
agcatagatttcctcgtggtcaatgtgacggaagccactctcatctctggcgtcgaaatc
aacgaggaggcatcgaaggaggagatctggaaacaagctgaccaagctgcggataccctg
ttcaagatgggaatcaaggaggccgttgttgtcactctgggaggtaacggtgtcatttac
aagaccaagactgattctggacatgttccttctaacaaggtcgagaagattgtcgatact
actggtgctggagacactttccttggaggtttctccactagcattatccagggaaagaca
gtctccgaggccattgctttcggaaacaaggctggtggtattgctgtcactcgacgaggt
gctgctgagggtatcccttacgatcatgagctttaa

DBGET integrated database retrieval system