KEGG   Yarrowia lipolytica: YALI0B15906gHelp
Entry
YALI0B15906g      CDS       T01033                                 

Definition
YALI0B15906p
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
yli  Yarrowia lipolytica
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:yli00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YALI0B15906g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     YALI0B15906g
Protein kinases [BR:yli01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   YALI0B15906g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:complement(2107255..2109435)
Genome map
AA seq 726 aa AA seqDB search
MSSPPSLSDLSLNDRNPDRHPLKGLHEARGIRKVSLHSRSGSVAEEEEPSSTDSNAATAS
HPPADQLSEVSAETLARIQAIHMSRMSRDRSHSSPPEPEQEQLQQLQDRTPPSWQTQRPH
PHVTTDFGPQLTSPEISPFTTASSVPRNSDHSFSQFQTGSLPKSYTGGVIPPGVTASPLN
GPLTGPLTGPLTGPLTGGTKPVSRQSSLSSRRGMRLPGSPLVSDDECSQNPAASTPKPMN
LHLPDYSKLSYNGDNNGSSSADSRSRESSSSSNASSTSTTPSCALTGGLTGPTVQTGARL
PGRLSSQNSIKRKGPGKLSLSGSPSSSPVTPSDGSAVPLPIAKDQAPAQGAPAQGGGLFA
QFSKIVDINTGKLNFAGKASLHSEGIDFSGGTSFRINIDELEPLGELGRGNYGTVTKVLH
KPTGITMAMKEVKLELDTAKFAQIIMELDILHKCESPYIVDFFGAFFVEGAVYECIEYMD
GGSLDKVYAGGVDEPCLAAITDSVVRGLMFLKEEHNIIHRDVKPTNILINTEGKVKLCDF
GVSGNLVASKASTVIGCQSYMAPERIHNPDSGNVTYTANSDIWSLGVSILEIAQGSYPYP
PEAYNNVFAQLRAIVSGDPPQLAERFSPEARDFVAQCLQKKPYQRPTYQQLLEHPWLKKY
RGVDVGMADFVKKALERGKNATSTSNETTPTGTTIPVSRNNPGLVSRDGRNNMVPALHHS
FLNNRQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccgccgtcgctgtcagacttgtcgctgaacgatcgcaatcccgatcgccac
ccccttaaggggctgcatgaggcccggggtatccgtaaggtgtcattacactcgcgctca
ggctctgtggccgaagaagaagagccttcctccacagactccaatgctgctacagcttct
catccaccagctgaccagttgtcagaagtgtcagcagaaacgctggcccgtatccaggcc
atccatatgtcgcgaatgagcagagatcgatcccactcgtcgcctccagagcccgaacag
gaacagctccagcaactccaggaccgcaccccgccgtcgtggcagactcaacgaccccac
ccccacgtgaccaccgactttggcccacagctgacctcaccagaaatttcgcccttcacc
acagcgtcgtctgtgcctcgaaattcagaccatagcttctctcagttccagaccggctcc
ttgcctaaatcctacacaggtggtgtcatcccccctggcgttactgccagtcctctcaac
ggccctctcaccggaccgctgactggaccgctcaccggacctctgactggaggaaccaag
ccagtctcaagacaatcgtcgctgtcgtcgcgacgaggcatgagactgccaggatcccct
ctcgtctctgacgacgagtgcagccaaaacccggctgcctccacccctaaacccatgaat
ttgcatttacccgactactccaagctcagctacaatggtgacaacaatggtagttcttcg
gcagatagccgatctcgcgagagctcctcgtcctccaacgcatcatccacctccaccaca
ccctcctgtgccctcacaggtggactcacaggtcctaccgttcagacaggagcccgtctt
cccggccgactatcgtcgcaaaactccatcaagcgaaagggccccggaaagctgtcgctc
agcgggtcgcccagcagtagtcctgtgactccatccgatggaagtgctgtccccctgccc
attgccaaagaccaggctccagcccagggagcccctgctcagggaggcggtctgtttgca
cagttttcaaagatcgtcgacatcaacacgggaaaactcaactttgctggaaaggccagc
ttgcattcggaaggtatcgacttctcgggaggtacgtcgttccgaatcaacattgacgag
ctggagcctctgggagagctgggacgaggcaactacggaactgttacaaaggtgctgcat
aagcccacaggtatcaccatggcaatgaaggaggtaaagctggagctggacaccgccaaa
tttgcccagataattatggagctggatattctacacaagtgcgagtctccatacattgtc
gactttttcggcgccttctttgtagagggagctgtttacgaatgcattgagtacatggac
ggaggatcactggacaaggtgtatgcaggaggtgtggatgagccctgcttggctgccatc
accgacagtgtggttcggggtcttatgttcctgaaggaggagcacaatattatccacaga
gatgtcaagcccacgaatattctcatcaacaccgaaggaaaggtcaagttgtgtgatttc
ggagtgtccggcaacctcgttgcatccaaggcatccactgtgatcggatgccagtcatac
atggcacccgagcgtatccacaaccccgattctggcaacgtgacatacactgccaattct
gacatttggagtttgggcgtaagtatcctggaaatcgcccaaggctcatacccttaccct
cctgaagcatacaacaatgttttcgcccagttgcgagccattgtgtctggtgatccccct
cagcttgccgagcggttctctcctgaggcacgggactttgttgcccagtgtctgcagaag
aagccctaccagcggcccacttaccagcagttactggagcatccctggctcaagaagtac
cggggcgtggacgttggcatggccgatttcgtgaagaaggccctggaacgtggtaagaac
gccacttccacttccaacgagaccaccccaacgggcaccactatccctgtgtcccgcaac
aaccctggtttggtttcccgtgacggacgaaacaacatggttcctgctttgcatcatagc
ttcctcaacaatagacaataa

DBGET integrated database retrieval system