KEGG   Yarrowia lipolytica: YALI0B15906gHelp
Entry
YALI0B15906g      CDS       T01033                                 

Definition
YALI0B15906p
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
yli  Yarrowia lipolytica
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:yli04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:complement(2107255..2109435)
Genome map
AA seq 726 aa AA seqDB search
MSSPPSLSDLSLNDRNPDRHPLKGLHEARGIRKVSLHSRSGSVAEEEEPSSTDSNAATAS
HPPADQLSEVSAETLARIQAIHMSRMSRDRSHSSPPEPEQEQLQQLQDRTPPSWQTQRPH
PHVTTDFGPQLTSPEISPFTTASSVPRNSDHSFSQFQTGSLPKSYTGGVIPPGVTASPLN
GPLTGPLTGPLTGPLTGGTKPVSRQSSLSSRRGMRLPGSPLVSDDECSQNPAASTPKPMN
LHLPDYSKLSYNGDNNGSSSADSRSRESSSSSNASSTSTTPSCALTGGLTGPTVQTGARL
PGRLSSQNSIKRKGPGKLSLSGSPSSSPVTPSDGSAVPLPIAKDQAPAQGAPAQGGGLFA
QFSKIVDINTGKLNFAGKASLHSEGIDFSGGTSFRINIDELEPLGELGRGNYGTVTKVLH
KPTGITMAMKEVKLELDTAKFAQIIMELDILHKCESPYIVDFFGAFFVEGAVYECIEYMD
GGSLDKVYAGGVDEPCLAAITDSVVRGLMFLKEEHNIIHRDVKPTNILINTEGKVKLCDF
GVSGNLVASKASTVIGCQSYMAPERIHNPDSGNVTYTANSDIWSLGVSILEIAQGSYPYP
PEAYNNVFAQLRAIVSGDPPQLAERFSPEARDFVAQCLQKKPYQRPTYQQLLEHPWLKKY
RGVDVGMADFVKKALERGKNATSTSNETTPTGTTIPVSRNNPGLVSRDGRNNMVPALHHS
FLNNRQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccgccgtcgctgtcagacttgtcgctgaacgatcgcaatcccgatcgccac
ccccttaaggggctgcatgaggcccggggtatccgtaaggtgtcattacactcgcgctca
ggctctgtggccgaagaagaagagccttcctccacagactccaatgctgctacagcttct
catccaccagctgaccagttgtcagaagtgtcagcagaaacgctggcccgtatccaggcc
atccatatgtcgcgaatgagcagagatcgatcccactcgtcgcctccagagcccgaacag
gaacagctccagcaactccaggaccgcaccccgccgtcgtggcagactcaacgaccccac
ccccacgtgaccaccgactttggcccacagctgacctcaccagaaatttcgcccttcacc
acagcgtcgtctgtgcctcgaaattcagaccatagcttctctcagttccagaccggctcc
ttgcctaaatcctacacaggtggtgtcatcccccctggcgttactgccagtcctctcaac
ggccctctcaccggaccgctgactggaccgctcaccggacctctgactggaggaaccaag
ccagtctcaagacaatcgtcgctgtcgtcgcgacgaggcatgagactgccaggatcccct
ctcgtctctgacgacgagtgcagccaaaacccggctgcctccacccctaaacccatgaat
ttgcatttacccgactactccaagctcagctacaatggtgacaacaatggtagttcttcg
gcagatagccgatctcgcgagagctcctcgtcctccaacgcatcatccacctccaccaca
ccctcctgtgccctcacaggtggactcacaggtcctaccgttcagacaggagcccgtctt
cccggccgactatcgtcgcaaaactccatcaagcgaaagggccccggaaagctgtcgctc
agcgggtcgcccagcagtagtcctgtgactccatccgatggaagtgctgtccccctgccc
attgccaaagaccaggctccagcccagggagcccctgctcagggaggcggtctgtttgca
cagttttcaaagatcgtcgacatcaacacgggaaaactcaactttgctggaaaggccagc
ttgcattcggaaggtatcgacttctcgggaggtacgtcgttccgaatcaacattgacgag
ctggagcctctgggagagctgggacgaggcaactacggaactgttacaaaggtgctgcat
aagcccacaggtatcaccatggcaatgaaggaggtaaagctggagctggacaccgccaaa
tttgcccagataattatggagctggatattctacacaagtgcgagtctccatacattgtc
gactttttcggcgccttctttgtagagggagctgtttacgaatgcattgagtacatggac
ggaggatcactggacaaggtgtatgcaggaggtgtggatgagccctgcttggctgccatc
accgacagtgtggttcggggtcttatgttcctgaaggaggagcacaatattatccacaga
gatgtcaagcccacgaatattctcatcaacaccgaaggaaaggtcaagttgtgtgatttc
ggagtgtccggcaacctcgttgcatccaaggcatccactgtgatcggatgccagtcatac
atggcacccgagcgtatccacaaccccgattctggcaacgtgacatacactgccaattct
gacatttggagtttgggcgtaagtatcctggaaatcgcccaaggctcatacccttaccct
cctgaagcatacaacaatgttttcgcccagttgcgagccattgtgtctggtgatccccct
cagcttgccgagcggttctctcctgaggcacgggactttgttgcccagtgtctgcagaag
aagccctaccagcggcccacttaccagcagttactggagcatccctggctcaagaagtac
cggggcgtggacgttggcatggccgatttcgtgaagaaggccctggaacgtggtaagaac
gccacttccacttccaacgagaccaccccaacgggcaccactatccctgtgtcccgcaac
aaccctggtttggtttcccgtgacggacgaaacaacatggttcctgctttgcatcatagc
ttcctcaacaatagacaataa

DBGET integrated database retrieval system