KEGG   Yarrowia lipolytica: YALI0B16698gHelp
Entry
YALI0B16698g      CDS       T01033                                 

Definition
YALI0B16698p
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YALI0B16698g
Peptidases [BR:yli01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   YALI0B16698g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:complement(2198890..2199807)
Genome map
AA seq 305 aa AA seqDB search
MSSIGWNTIESDCGVFTTLVEELGVSGIEFFDVLSIDPDSLAQFNPLYGIIFLYKYRKSE
YAVSREYSETEKNASGQFFFAHQKIQNACATQAILSVLCNLPEDIEIGPILSNFKEFSRD
IDPETRGEILGMSDEIRQAHNSFSRPNPFESGDDDRETPDEENDGLYHFVAYVPINGQLW
ELDGLKQYPVNYGGCTNEEFPEKVSSVLMERVQKAPGGDLRFSVLAVSRDRREVLKENGG
STTELVVEDLKRKEWTRDNALRRETFVGLINELVKGVVGGMGDEQYKKALEQGREKTKEM
YAKRA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaatcggctggaacaccatcgaatcggactgtggcgttttcaccactctggtg
gaggagctcggagtctctggaatcgagttcttcgacgttctctctatcgatcccgactct
ctggctcaattcaaccctctgtacggtatcatatttctgtacaagtaccgaaagagcgaa
tacgccgtctctcgagaatactctgagactgagaagaacgccagcggccaatttttcttt
gcccaccagaagatccagaatgcttgcgccacccaggccatcctcagtgtactgtgcaac
ttgccagaggacattgaaatcggaccaatcctgtcaaatttcaaggaattctcgcgtgac
attgatcccgagacgaggggagagattcttggaatgtctgatgaaatccgtcaggctcat
aactcgttcagcagacccaacccctttgagtccggcgacgatgaccgagaaaccccagac
gaggagaacgacggtctgtaccactttgtggcctatgtgccaatcaacggacaattgtgg
gagcttgatggattgaaacagtaccctgtcaactacggtggctgcacaaatgaagagttc
cccgaaaaggtcagcagtgtgctaatggagcgtgtacagaaggcccccggaggggacttg
cggttctccgtacttgctgtgtctcgagacagacgggaagtgctcaaggagaatggcggg
tccactaccgagcttgtggtagaagatcttaagcgaaaagaatggactcgggacaacgct
ctgcgacgagaaacatttgtgggtcttatcaacgagttggtgaagggtgttgttggcggc
atgggcgatgagcagtacaagaaggctcttgaacagggtcgagagaagacgaaggagatg
tatgccaagcgggcttag

DBGET integrated database retrieval system