KEGG   Yarrowia lipolytica: YALI0B17072gHelp
Entry
YALI0B17072g      CDS       T01033                                 

Definition
YALI0B17072p
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     YALI0B17072g
Peptidases [BR:yli01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YALI0B17072g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YALI0B17072g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:2250061..2252340
Genome map
AA seq 759 aa AA seqDB search
MDPYTEAAINLQPPNGRPVHKDDCAYSFDTPDLQGGLDVCLSCFQASSAHANQDYTKLHF
DNTGHSYFATVHKKRKAKARSDENAPKRLAIEAHKEEDDWDTQWGVKLVTAVGSEKLDET
REPFPELLAAVENAESFAARSEVAAWENEIVSCEHTRNLNQSAAPDLNFSAPHCAQCDLK
ENLWLCLDCGAIGCGRAQFGGVAGNTHALAHSETTGHGVAVKLGSITAHSADVYCYICND
ERQDPELRKHLSHFGIQIDDLQKTEKSMTELQIEQNYTWQFSMENESGEIKPVFGPGLTG
MNNLGNSCYLNSAMQVIFSLPAFQKQFNVPQQFIADPINSHVTQFRKLADGLLSGRYAVP
DVYDDSEVSYQRGIRPFALKTLLGKGHPEFSTNRQQDAFEFWAHVTDIIDNKIEGGRALT
DIFRFQTEKRLQCLSCNKVRYTKEAQENLSVPVPIREKGEQDGKTVYEDVELSECLIKYT
GAQTTDYSCKCGGKEASVSNKFASLPDVLVLNSTRFQIKNWVPMKVDVNLNVDENLNLDD
YISPGKQDNEEELPEDEAGEGNSSGWTANETAVEILSAMGFPTVRCEKALYHTGNSDPDA
AMNWLFSHMEDADIDEPLVIDSSVPSSGSTDNSAAIAQVAEMGFTPNQARKALRECSGNV
EMAVAWLFENPADEGEEESAAVATEVASSGPVGYTEKPHNYELTGIICHKGTSVHAGHYV
AYVKKDGKWILFNDEKVVSSSVEDMKKLAYVYVFQRVSA
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatccatacaccgaagccgccatcaatttacagcctcccaacggcagacccgtgcac
aaggacgattgtgcatactccttcgacactcccgatcttcaaggcggactcgatgtctgt
ctcagctgtttccaagcctcttcagcccacgccaaccaggactacacaaagctccatttc
gataacactggccattcgtactttgcaaccgtgcacaagaagcgcaaggccaaggctcga
tccgacgagaatgcgcccaaacgtttggccattgaggcccacaaggaggaggatgactgg
gacactcagtggggagtcaagctggtgacggctgtgggctcggagaagctggacgagacc
cgagagcctttcccggaacttctggctgcggtggagaatgccgaatcgtttgctgctcgt
tcggaggttgctgcctgggagaacgagatcgtttcctgtgaacacacccgcaacctgaat
cagtctgccgcacctgatcttaatttctctgctccccattgcgcccagtgcgatctcaag
gagaacttgtggctgtgcctggattgtggagcaattggatgtggacgagcacaatttgga
ggagtggctggaaacacccatgctctggcccactccgagaccactggccatggagtggct
gtcaagcttggatccatcacagcccactctgccgacgtctactgctacatttgtaacgac
gaacggcaggatcctgagctccgaaagcacctgtcccatttcggaatccagattgacgac
cttcaaaagacagaaaaatctatgacggagctccaaattgaacagaattacacgtggcag
ttctccatggagaatgagtccggtgagatcaagcctgtgtttggacctggacttacaggc
atgaacaacctcggaaactcgtgctacctcaattcggccatgcaagtgatattctctcta
cccgcgttccagaagcagttcaacgtgcctcagcagttcattgctgaccctattaactct
catgtgacacagtttagaaaactggccgacggtctgttgtctggacggtacgccgtgcct
gatgtttacgatgactcagaggtgtcgtatcagaggggtatccgacctttcgcattgaag
actctgctgggtaagggccaccccgaattctctaccaaccgacagcaggatgcctttgag
ttctgggctcatgtgacggacattattgacaacaagattgaaggaggtagagccctgact
gatatcttccgattccagaccgaaaagcgactccagtgcctttcttgtaacaaggtgcgg
tacaccaaggaagcccaggaaaacctcagcgtgccagttcccataagagagaagggagag
caggatggaaagaccgtttacgaagacgtggaactgtctgaatgccttattaaatacact
ggagcccagaccaccgattactcgtgcaaatgtggtggcaaggaggcctctgtgtccaac
aagtttgcatctctgcctgatgttcttgttctgaattcaaccaggttccagatcaagaat
tgggtgcccatgaaggtcgatgtcaatctcaatgtcgacgagaacctcaatctagacgat
tacatttcgcctggtaagcaggacaacgaggaggagcttcccgaagacgaggcaggcgag
ggaaactcgtctggatggaccgctaatgagacagcagtcgagattctttcggcaatggga
ttccctactgttcgatgtgagaaggctctttaccataccggtaactccgatcccgatgct
gccatgaactggctgttttcgcacatggaggatgcggatatcgacgaacctttggttatc
gactcctctgttcctagcagtggctccaccgacaactctgctgccatagctcaggttgca
gagatgggtttcactcccaaccaagccagaaaggcccttcgagagtgttcaggaaacgtg
gagatggctgtagcttggctttttgagaatcctgcagacgagggagaggaggaatctgca
gctgtcgcaaccgaggtagcctcgtctggtcctgttggttatactgagaagccacacaat
tacgagctgacaggcatcatctgccacaagggtacttctgttcacgctggtcactacgtt
gcttacgtgaagaaagatggaaaatggatccttttcaacgatgagaaggtggtttcttcc
tctgttgaagacatgaagaagctggcatacgtctatgtgttccagcgagttagtgcataa

DBGET integrated database retrieval system