KEGG   Yarrowia lipolytica: YALI0B18920gHelp
Entry
YALI0B18920g      CDS       T01033                                 

Definition
YALI0B18920p
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
yli  Yarrowia lipolytica
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:yli00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:yli00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:yli03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:yli03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:yli03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:yli03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:yli03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:2486873..2487379
Genome map
AA seq 168 aa AA seqDB search
MAPKSAKQASLSFKSTKPSIKRDFKVVKQQQQQHNDIKTKDVKPPVQIESIETTICDELV
REEAEKINSLPELDPSEKVYSDEAHKIAEKSIAPPVHPEEVNNCEKILKNFDFTVDFGPV
VGLTRLERWERANKLGLNPPAVVKKILETKQGETEDVYKQSYLYDQLV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaaatctgcaaaacaggcgtcgctgagcttcaagagcaccaagcccagcatc
aagcgggatttcaaggtcgtcaagcagcagcagcagcaacacaatgatatcaagaccaag
gacgtcaaaccgccagtacagatagagtcgattgaaaccaccatctgtgacgagctggtc
agggaggaggctgaaaagatcaattctctgccggaattggatcccagtgaaaaggtgtac
tcggacgaggcccacaagatcgccgaaaagagcattgcaccacccgtgcatcccgaagag
gtcaacaactgcgaaaagattctcaagaactttgactttaccgtcgacttcgggcctgtt
gtcggtctgacccggctggaacggtgggagagagccaacaagctgggactcaatccccca
gctgtggtgaagaagattctcgagaccaaacagggagagacagaggatgtctacaagcag
tcgtacctctatgatcagcttgtgtaa

DBGET integrated database retrieval system