KEGG   Yarrowia lipolytica: YALI0B18920gHelp
Entry
YALI0B18920g      CDS       T01033                                 

Definition
YALI0B18920p
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
yli  Yarrowia lipolytica
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YALI0B18920g
   00240 Pyrimidine metabolism
    YALI0B18920g
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YALI0B18920g
   03410 Base excision repair
    YALI0B18920g
   03420 Nucleotide excision repair
    YALI0B18920g
   03430 Mismatch repair
    YALI0B18920g
   03440 Homologous recombination
    YALI0B18920g
DNA repair and recombination proteins [BR:yli03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      YALI0B18920g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
B:2486873..2487379
Genome map
AA seq 168 aa AA seqDB search
MAPKSAKQASLSFKSTKPSIKRDFKVVKQQQQQHNDIKTKDVKPPVQIESIETTICDELV
REEAEKINSLPELDPSEKVYSDEAHKIAEKSIAPPVHPEEVNNCEKILKNFDFTVDFGPV
VGLTRLERWERANKLGLNPPAVVKKILETKQGETEDVYKQSYLYDQLV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaaatctgcaaaacaggcgtcgctgagcttcaagagcaccaagcccagcatc
aagcgggatttcaaggtcgtcaagcagcagcagcagcaacacaatgatatcaagaccaag
gacgtcaaaccgccagtacagatagagtcgattgaaaccaccatctgtgacgagctggtc
agggaggaggctgaaaagatcaattctctgccggaattggatcccagtgaaaaggtgtac
tcggacgaggcccacaagatcgccgaaaagagcattgcaccacccgtgcatcccgaagag
gtcaacaactgcgaaaagattctcaagaactttgactttaccgtcgacttcgggcctgtt
gtcggtctgacccggctggaacggtgggagagagccaacaagctgggactcaatccccca
gctgtggtgaagaagattctcgagaccaaacagggagagacagaggatgtctacaagcag
tcgtacctctatgatcagcttgtgtaa

DBGET integrated database retrieval system