KEGG   Yarrowia lipolytica: YALI0C00165gHelp
Entry
YALI0C00165g      CDS       T01033                                 

Definition
YALI0C00165p
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
yli  Yarrowia lipolytica
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:yli00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    YALI0C00165g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     YALI0C00165g
Peptidases [BR:yli01002]
 Metallo Peptidases
  Family M67
   YALI0C00165g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:complement(15006..16343)
Genome map
AA seq 445 aa AA seqDB search
MLSIAEIAAKGLDYPYTNNTSFRVWIHVVGTVLREAEIYRDDGDFEKAYLLYTRFADLLL
NKMPGHPGLKANRALFKKMTGKMPGVLQEMQQLKKALEVQITEEKKAEEERQRKLRALQQ
ASDSGRSGGSRGSGSTSRIDDLRSQLGQGGPDHVNLEDYSFGRYDTRQVSEPMYEHGNWQ
QQAHHQHDTFDYPDLNRELSSVLSPYVYESGPLTLSPTAGQIRLADSPPAIPAKPAALKA
SYEKPAAPAPPTTSSSSVEHTSRYTTEGGLALRSLFIPAELEATFLKVAHANTVKNLETC
GILCGKLSRNAFFVTHLMIPPQESTSDTCQTTNEELLFEQIDENDLFVLGWIHTHPTQTC
FMSSVDLHTQNSYQIMLPEAVALVCAPQHDPNFGIFRLSDPPGVDIIKNCNRGGFHPHTE
DNIYNNARHAMVKNGLPFKMKDLRS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgttatcgatagcggaaatcgcagccaaagggctggactacccctatactaacaacacc
agcttccgtgtatggatccacgtggttggcacggttctgcgcgaggctgaaatttaccgc
gatgatggtgatttcgagaaggcttatctgctgtacacgcggttcgcagacctgttgctc
aacaagatgcctgggcatcccgggctcaaggccaacagggcgctattcaagaaaatgacc
ggcaagatgcccggggttctgcaagagatgcagcagctgaagaaggctcttgaggtgcaa
atcacggaggagaaaaaggctgaggaggaacgacaacgaaaactacgagcattacaacaa
gcctccgacagtggaagaagcggtggcagcaggggcagcggaagtacgagccgtattgac
gacctgagatcacaacttggtcaaggaggcccagatcatgtgaatttggaagactattca
tttggtcgatatgatacacgacaagtgtctgagccaatgtacgagcatggaaactggcaa
caacaagcacatcatcaacatgatacgttcgactatcccgatctcaaccgggagttatca
tccgttctttcaccctacgtttatgagtccggaccacttacgctgtcgcctacagctggc
cagattcgacttgcggactcacctccagcgatcccagctaaaccagcagcattaaaagca
tcatatgagaaaccagccgccccagcaccacctacaacgtcatcttcatctgtggaacac
acttcacgatacaccactgaaggaggactggccctgcggtccctgttcattccggctgag
ttggaggccaccttcctcaaggttgcgcacgccaacaccgttaaaaacctcgagacctgc
ggtattttatgcgggaagttgtcgcgaaatgcattcttcgtcacacatctgatgatccca
cctcaggaaagcacctctgacacgtgtcagacaacgaatgaggagcttctatttgagcag
attgatgaaaatgatctctttgtactcggatggatccacacacaccccacacagacctgt
ttcatgtcatctgtggacctgcatacccagaattcgtatcagatcatgctgcctgaggct
gtggctcttgtgtgcgcgcctcagcatgatcccaactttggcatcttcagactgtcggat
cctccgggtgttgacattatcaagaactgtaacaggggcggtttccacccgcatacagag
gataacatttacaacaatgctcgacatgctatggtcaagaacggtctcccgttcaagatg
aaggacctgagatcataa

DBGET integrated database retrieval system