KEGG   Yarrowia lipolytica: YALI0C02717gHelp
Entry
YALI0C02717g      CDS       T01033                                 

Definition
YALI0C02717p
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     YALI0C02717g
Peptidases [BR:yli01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YALI0C02717g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:complement(376226..377971)
Genome map
AA seq 581 aa AA seqDB search
MGGGKNGQVTVGGLENDSAFCFMNSVLQSMASLDRLDEFLGGTQYEGVELDTTTRKRYEE
SENEDDSDEGAENGPEGPVSEAETEIDQVPDRTQPTVPEGASAVPEAEDDLVEVNAVAEE
EEQEEELKQPSALELSSLIPGFPAQPEKADPEEVTEVTETSTTVQNPICPSSLESFHSST
GLGAFSYELKRMFAQLNTLSNRSHTYSGLPITRAMGKSGQRWDGYEQEDAGEFFQQLIDR
LENEVKAKAGGADKVEEKTISEDTSALDKWKKKMLIPFDGVQATTIKCLTCGDLGDGIRY
NIMGALGLSLPNQTSRFSRSTHTLKECIDMFAEREIIDGVSCERCSLQEYKRQVEDQISK
VADTASPLVQLFQTRLDKVDTALSRDTINEEEYNDIFKKNTGGFAKVFVQKSKQTLIGVA
PQILCVTINRSQFDMNTGMSFKNSANVRFPSLLCLDEWMDDKSQTKKMYRLKSVVSHYGS
HDYGHYIAYRLSRDKWWRISDETVYQTELSYVLSDGSIFMLFYELAAPEEAEELYTQMIE
EQKEQQSHGSGAVDSSEEDESDEEDESEADKEEESEDEDME
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaggcaagaacggtcaggtgaccgtgggtgggctggagaatgactcggccttt
tgtttcatgaactccgtgctccagtccatggcttctcttgatcggctggacgagtttttg
ggaggaactcagtacgaaggcgtggaactcgatactactacccgcaagcggtatgaagag
agtgagaacgaggatgacagcgacgagggcgccgagaacgggcctgagggtcctgtttct
gaggctgagacggagattgaccaggtccctgaccggacccagcctactgtgcctgaagga
gcttctgcagtccctgaagctgaagacgatctggtagaggtgaatgctgtggctgaggag
gaggaacaggaggaggagctcaaacaaccctcggctctggagctatcttctttgattccc
ggtttccccgcccaacctgagaaggctgatcccgaggaagtgaccgaggtaactgaaacg
tcgactacggttcagaatcctatctgtccgtcgtcgctcgagtcattccactcatccacc
ggactcggagccttttcctacgagctcaaacgaatgtttgctcagctcaacaccctctcc
aacagatcgcacacctactcgggtctgcccatcacacgagccatgggcaagagcggccag
cgatgggacggatatgaacaggaggacgctggcgagtttttccagcagcttatcgacagg
ctggaaaacgaggtcaaggccaaggctggaggagcagacaaggttgaggagaagactatc
tctgaagacacttccgcgctcgacaaatggaagaagaaaatgctcattccgttcgacgga
gtccaagcaaccaccatcaagtgtctcacatgtggagacctcggtgacggcattcgatac
aacatcatgggagctctgggtctgtctctccccaaccagacctctcggttctcccgatcc
actcacactctcaaggaatgcattgacatgtttgctgagcgggagattattgatggtgtg
agctgtgaacgatgctcgttgcaggaatataagagacaggtggaggaccaaatcagcaag
gttgcagacacagcatcacctctggtgcaactgtttcagaccagactcgataaggtcgac
actgctctgtcacgtgacaccattaacgaggaggagtacaacgatatcttcaaaaagaac
accggcggctttgccaaggtgtttgttcaaaagtccaagcagactctcattggggtagcc
cctcagattttgtgtgtgaccatcaaccggtcgcagtttgacatgaacactggtatgagt
ttcaagaactcggctaatgtgcggttcccgtctctgctgtgtctggacgagtggatggac
gacaagtcgcagaccaaaaagatgtaccggctcaagtccgtcgtgtcgcactacggatca
catgactacggacactacattgcgtatagactgtctcgagacaagtggtggcgtatttct
gacgagactgtttaccagaccgagctctcatacgtgctgtctgatggttccatcttcatg
cttttctacgaactggctgccccggaagaagccgaggagctgtacactcagatgattgag
gagcagaaggagcagcagagtcatggatctggagctgtagatagcagtgaggaggacgag
agtgatgaggaggacgaaagtgaggccgacaaagaggaggagagcgaagacgaagatatg
gagtag

DBGET integrated database retrieval system