KEGG   Yarrowia lipolytica: YALI0C04180gHelp
Entry
YALI0C04180g      CDS       T01033                                 

Definition
YALI0C04180p
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
yli  Yarrowia lipolytica
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    YALI0C04180g
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    YALI0C04180g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     YALI0C04180g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:557590..560457
Genome map
AA seq 955 aa AA seqDB search
MSLEHIAPLDLENRPQRAIARYKSLEALRGRKDSYPPLRNSVIQETQDDSALDLELSEHS
DPNDTNDPNDTNNSNDTSLFATDLSPAASAPVLGTVPPLIPPIVTNTTPFSVPISPRLST
SSSPRFSPRFSPSSLANTLASSLSISPTLGSTVMELPTALARKLSRRGLSTSPPFRSRSS
SCPSVEMPITRHKNSEEQSAGNVATVSSILSSESAEVTVPLVLQQGMPFLRITHKKKVQR
MFKIDPVTGKVSWDDKKASACFSVDTICEISLQENARNHREELKVSSNHESRWVTITYMK
NKRRKPLHLVAPTKEEFTLFVDALQNLVYFRQELMRGFQSSNPKIASVHWKSYAAKEQGE
ERLTFEAVQRLAQRHHVLCSKAYLKSKFDEADVDKSGFLEFNEFKIFVKLLKRRPEIVTL
YYQTLGKPEPANIWSDDRMTRDDLLGFLDHVQRTRFEPHIFEKIWAKFAPKDDTFDSSLD
YWTVDSFNDFLLSSYNLFVKPETNLNRPLNEYYISTSHNTYLIGRQVADTSSEEGYIRAL
QSGCRSVEIDIWDGPDDRPVVKHGRTFTSSVSVEDVCSAIRKYGFIASPNPLILSLEIHC
SASNQLKVVDILKGTFGENLVTQPLVPGALNLPSPHELKHRVLIKVKAGREPVAGDKNNG
ASFSSSYTSSSTTTASEFDDLSGTPSVSGGGKRKDTSGTTKKIVPALGELGVYVQGLKFR
NFAFPESKTTNHCFSFSERKFISICKDPENREQMMKHNRRYLTRIYPSGYRVKSSNLNPL
YFWQNGAQMVALNWQTYDLPAQLNDAMFAARGGYVLKPPYLRHLKSPRSGHSVNLSFISA
QQLPRPKDLGKSSFDPYIVAQLHGPGENHKLKTSPVIDNGFNPRWNKDWSLSLSPEDYEF
SFVQITLYTQDRPFAVSCLRLSSLNEGYRHVPLNDLQGEEYLFSTLFMKVSKISN
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgtcattggaacatatagcaccgctggatctggagaaccggccccagcgggcaatcgcc
agatacaagagcctggaggctctgagaggccgcaaagacagctatccgccgctccgaaac
agtgtgatccaagaaacgcaggacgattcggctctggacctcgaactgtcggaacacagt
gacccaaacgacaccaacgaccccaacgacaccaacaactccaacgacacaagcctgttc
gccacagatctctcgccagcagcatcggcacccgtgctgggaacagtgccgccactcatt
ccgcctatcgtcacaaacacaaccccattctctgtgcccatcagtcctcgtctgagcaca
tcctccagtcctcggttttcgcctcggttttcgccctcctcgctcgcaaacactctcgca
tcttccctcagcatcagcccgactctcggatccaccgttatggaacttccgaccgccctc
gcccgcaaactctcccgccgaggcctttcgacaagcccccctttccgaagcagaagcagc
agctgccccagcgtggaaatgccaatcacacgacacaaaaactcggaggaacaatcggcc
ggaaacgtggccacagtatcgtctattctctcctctgaatcagcagaggtcacggtgccg
ctcgttctacagcagggaatgccttttctacgtatcacacacaagaaaaaggtgcaacgc
atgttcaaaatcgaccctgttacaggaaaggtgtcgtgggacgacaagaaggccagtgca
tgtttctcggttgacaccatctgtgagatttcgctgcaggaaaacgcccgcaaccacaga
gaagaactcaaagtctcgtccaaccacgaatcacgatgggtcaccatcacctacatgaag
aacaagcgccgcaagccgcttcatctggttgccccgaccaaggaggagtttacgttgttc
gttgacgctctgcaaaacctagtgtattttcgccaggagctgatgcggggcttccagtcc
tcgaatcccaagattgcctctgtgcactggaagtcgtacgcagccaaggagcagggtgag
gagagactcacattcgaagccgttcagcgtctcgctcaacgacatcacgtgctctgctca
aaggcatatctcaagtctaaatttgatgaggccgatgtcgacaagtccggctttctggag
ttcaacgagttcaagatctttgtgaagctgctaaaacgacgcccagagattgtcaccttg
tactaccagactcttggcaagcctgaaccagccaacatctggagtgatgatcgtatgact
cgagacgatctgcttgggttccttgatcacgtgcagagaacccggtttgagccccatatc
tttgagaagatctgggccaaattcgcccccaaagacgacacattcgactcctcgctcgat
tactggacagttgattcgttcaacgatttccttctgtcttcctacaatctgtttgtcaag
ccagagacgaatctcaaccgaccactcaacgagtactacatctccacgtctcacaatacg
tatctgattggtcgtcaggttgcagacacctcgtctgaagaagggtacatccgagctcta
caatctggctgtcgatcggtcgagattgatatctgggacggacccgatgaccgtccggta
gtaaagcacggccgaacattcacctcatcggtgtctgtggaagacgtgtgctctgccatt
cgaaagtacgggttcattgcatcccccaaccctttgattctttccttggaaatccactgc
tcagcctctaatcagctcaaggtagtcgatattctcaagggcacttttggcgagaatctg
gtcactcaacctcttgttcctggggctctcaatctcccgtcgcctcatgagctcaaacat
cgagttcttattaaggtgaaggccggcagagagcccgttgcaggcgataaaaataatggt
gcctcattctcgtcgtcctacacatcctcttctactaccacagcctctgagtttgacgac
ttgagcggtactccttccgtttcaggcggaggaaaaagaaaggacacgagtggcacgacc
aagaagattgttcccgctctgggcgagctaggtgtttatgtccaaggtctcaagttccga
aactttgcattcccggaatccaagaccactaaccattgcttttccttctccgagcgaaaa
ttcatttccatctgcaaggaccccgagaacagggagcagatgatgaaacacaatcgacga
tacttgacgcgaatatacccctcgggctaccgtgtcaaatcgtctaacctcaacccgctc
tatttctggcagaatggagcgcagatggtggctcttaactggcagacatacgatctgccg
gcccagctgaatgacgccatgtttgctgcgcggggaggatatgtgctaaagccaccgtat
cttcgtcacctcaaaagtccccgatcaggccattctgtgaacttgtctttcatctctgcg
caacagctgcctcgaccaaaggatctgggaaagtcgtcttttgatccgtacattgtggct
cagctgcacgggcctggtgagaaccacaagttgaagacatcgccagttattgacaatggc
ttcaaccctcgctggaacaaggactggagtctgtctttgagtcccgaagactacgagttt
tcttttgttcagatcacgctgtacactcaggaccgtcccttcgcggtttcctgtctgaga
ctgtcgtcgctcaatgagggatatagacacgtgccattgaacgacctacagggggaggag
tatctgttctctaccttgtttatgaaggtgtccaagatctccaactag

DBGET integrated database retrieval system