KEGG   Yarrowia lipolytica: YALI0C04587gHelp
Entry
YALI0C04587g      CDS       T01033                                 

Definition
YALI0C04587p
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     YALI0C04587g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:complement(609248..611224)
Genome map
AA seq 658 aa AA seqDB search
MSTTIASPMSTPTTQDPGPTNNPFRHLQTNYSQLPRHMISPSLDKFSDSSSSYWGSRRST
GTKEPVGLAPEVPQNVVDDELQIIGAQVLRDASPGDGDDEDNSSEHTTASTSGSSTGGSP
SKKHQPNWHDFYKNGYPDEVIVIDSDSDDDHGDDVNNTQVAQVATTATTSKTTINRRISS
AADLPVKRRKFSQSSTSGSTTATHNTSSSDQQLDTNTHTTLDQDSDKNLLDDDENDTPLT
PPPKLRRKIPEVYVRPVADAKKLLASQYDDKDGHYVTTFSDVFTERYVIRKLLGQGTFGK
VVSAYDKQTDSLCAIKIIRAVPKYRDASKIELRVLTALADYDAMNKNRCIHLRECFDFRN
HVCIVTDLLDISVFDFMRDNRFQPFPGSHIQKLAKQLIKSVAFLHGLGLIHTDLKPENIL
LKKAAFVRVANKNLGPSSIRKHNYYRAHDPKKTEPKTRNVLKDTCIHLIDFGSAIFDDEY
HSSVVSTRHYRAPEIILGVGWSYACDMWSIGCILVELFTGDALFHTHEDFEHLALMEAII
GYPFPKAFVKEMISKKPSAQVGNFFNARSGKLGYPNKDTTTSSRHYIRDTLCLTDLIHTS
TQSTKSRSEGANPDGQFWDLFLDLVRKMLVFDPRERITAREALQHDWFKCGISDEGSV
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaacaatcgcctcgcctatgtccacgccgaccacccaggaccctggtccaacc
aataaccccttccgacacctgcagaccaactactcgcagcttccccgacatatgatctcc
ccttctctggacaagttttccgactcctccagctcgtactggggttcgcgacggtccacg
ggaactaaggaacccgtaggacttgcccccgaggtgccccaaaacgttgtcgatgacgaa
ctgcagatcatcggagcccaggtgctgcgagacgcgtctcctggcgatggagacgacgaa
gacaactcgtctgaacacaccacagcctcgaccagtggctcttccaccggcggctcgccc
tccaaaaagcaccagcccaactggcatgacttttacaaaaacgggtaccccgatgaagtc
attgttatcgactctgatagtgatgacgaccacggcgacgacgtcaacaacacccaagtg
gctcaagtagcaactactgccacgacgtcaaaaactactatcaaccgtcgaatttcgtcc
gccgctgacctgcccgtcaagcgacgaaagttctcgcaatcgtcgacatcaggctccacc
accgctacccacaacacgtcgtcctccgaccagcaactcgacacaaacacacatacaaca
ctcgaccaggactcggacaaaaatctgctggacgatgacgagaacgacactcctctgact
ccaccaccaaagcttcgtcgaaagatccccgaggtgtatgttcggcctgtggctgacgcc
aagaaactgttggcgtctcagtacgacgataaggacggccattacgtgaccacgttttcg
gacgtgttcaccgagcgatacgtcattcgaaagctgctcggacaaggcacttttggtaaa
gtcgtgtcggcttacgacaaacagactgactcgctatgtgccatcaaaataatccgagcg
gtgcccaagtaccgagacgcgtcgaaaatcgagctgcgtgttctcacagccttggccgac
tatgacgctatgaacaagaacagatgtattcatctgcgcgaatgcttcgacttcagaaac
catgtctgtatcgtcacagacctgctggacatttccgtctttgactttatgcgtgacaac
cggttccagcccttccctggctctcacattcagaagcttgccaagcagctcatcaagagt
gtggcctttttacacggtctggggcttattcacacggatctcaagcccgaaaacattcta
ctgaagaaggcagctttcgtgcgggtggccaacaaaaacctgggaccgtcgtcgatccgc
aaacacaactactaccgcgcacacgaccccaaaaagacggagcccaagactcgtaacgtg
ctcaaggacacatgtatccatctcattgactttggctcagccatctttgacgatgaatac
cactcgtcggtggtgtcgacgcgccactaccgggcccccgaaatcattctcggcgtgggc
tggtcttatgcctgtgatatgtggtccataggctgtattctggtggagctttttactgga
gacgccctgttccacacccacgaggactttgagcacctagcgctcatggaggccattatc
ggatacccgttccccaaggcgttcgtcaaggagatgatctccaaaaaacccagcgctcag
gtgggcaactttttcaacgcccgatccggcaagctcggataccccaacaaggacaccacc
acgagctcgaggcactacatccgagatactctgtgtctgacagacttgatccacacatcg
acgcaatccacgaagagccgcagcgaaggagccaaccctgatgggcagttctgggacctg
ttcctcgacttggtgcgcaagatgcttgtgtttgacccccgtgaacgaattactgctcga
gaggccctccagcatgattggttcaaatgtgggatttccgatgagggtagtgtttaa

DBGET integrated database retrieval system