KEGG   Yarrowia lipolytica: YALI0C05951gHelp
Entry
YALI0C05951g      CDS       T01033                                 

Definition
YALI0C05951p
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
yli  Yarrowia lipolytica
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    YALI0C05951g
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YALI0C05951g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     YALI0C05951g
Lipid biosynthesis proteins [BR:yli01004]
 Desaturase
  First
   YALI0C05951g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:764370..765818
Genome map
AA seq 482 aa AA seqDB search
MVKNVDQVDLSQVDTIASGRDVNYKVKYTSGVKMSQGAYDDKGRHISEQPFTWANWHQHI
NWLNFILVIALPLSSFAAAPFVSFNWKTAAFAVGYYMCTGLGITAGYHRMWAHRAYKAAL
PVRIILALFGGGAVEGSIRWWASSHRVHHRWTDSNKDPYDARKGFWFSHFGWMLLVPNPK
NKGRTDISDLNNDWVVRLQHKYYVYVLVFMAIVLPTLVCGFGWGDWKGGLVYAGIMRYTF
VQQVTFCVNSLAHWIGEQPFDDRRTPRDHALTALVTFGEGYHNFHHEFPSDYRNALIWYQ
YDPTKWLIWTLKQVGLAWDLQTFSQNAIEQGLVQQRQKKLDKWRNNLNWGIPIEQLPVIE
FEEFQEQAKTRDLVLISGIVHDVSAFVEHHPGGKALIMSAVGKDGTAVFNGGVYRHSNAG
HNLLATMRVSVIRGGMEVEVWKTAQNEKKDQNIVSDESGNRIHRAGLQATRVENPGMSGM
AA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaacgtggaccaagtggatctctcgcaggtcgacaccattgcctccggccga
gatgtcaactacaaggtcaagtacacctccggcgttaagatgagccagggcgcctacgac
gacaagggccgccacatttccgagcagcccttcacctgggccaactggcaccagcacatc
aactggctcaacttcattctggtgattgcgctgcctctgtcgtcctttgctgccgctccc
ttcgtctccttcaactggaagaccgccgcgtttgctgtcggctattacatgtgcaccggt
ctcggtatcaccgccggctaccaccgaatgtgggcccatcgagcctacaaggccgctctg
cccgttcgaatcatccttgctctgtttggaggaggagctgtcgagggctccatccgatgg
tgggcctcgtctcaccgagtccaccaccgatggaccgactccaacaaggacccttacgac
gcccgaaagggattctggttctcccactttggctggatgctgcttgtgcccaaccccaag
aacaagggccgaactgacatttctgacctcaacaacgactgggttgtccgactccagcac
aagtactacgtttacgttctcgtcttcatggccattgttctgcccaccctcgtctgtggc
tttggctggggcgactggaagggaggtcttgtctacgccggtatcatgcgatacaccttt
gtgcagcaggtgactttctgtgtcaactcccttgcccactggattggagagcagcccttc
gacgaccgacgaactccccgagaccacgctcttaccgccctggtcacctttggagagggc
taccacaacttccaccacgagttcccctcggactaccgaaacgccctcatctggtaccag
tacgaccccaccaagtggctcatctggaccctcaagcaggttggtctcgcctgggacctc
cagaccttctcccagaacgccatcgagcagggtctcgtgcagcagcgacagaagaagctg
gacaagtggcgaaacaacctcaactggggtatccccattgagcagctgcctgtcattgag
tttgaggagttccaagagcaggccaagacccgagatctggttctcatttctggcattgtc
cacgacgtgtctgcctttgtcgagcaccaccctggtggaaaggccctcattatgagcgcc
gtcggcaaggacggtaccgctgtcttcaacggaggtgtctaccgacactccaacgctggc
cacaacctgcttgccaccatgcgagtttcggtcattcgaggcggcatggaggttgaggtg
tggaagactgcccagaacgaaaagaaggaccagaacattgtctccgatgagagtggaaac
cgaatccaccgagctggtctccaggccacccgggtcgagaaccccggtatgtctggcatg
gctgcttag

DBGET integrated database retrieval system