KEGG   Yarrowia lipolytica: YALI0C06798gHelp
Entry
YALI0C06798g      CDS       T01033                                 

Definition
YALI0C06798p
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
yli  Yarrowia lipolytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YALI0C06798g
Enzymes [BR:yli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     YALI0C06798g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YALI0C06798g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:complement(905683..907758)
Genome map
AA seq 691 aa AA seqDB search
MTLQVCKDDPWLKPFEEELLRRQALVGQWKDHFAKEGGLAEFAASYKRYGLHVNKDNSVT
YREWAPGASEAVLTGDFNGWDRQQYHMTRDEYGLWSVTVPPTSDGQVAIPHNSKVKLALK
TSNGQWVDRLPAWSTYVVQDLSKSPIYEAVFWNPPESEKYQWKNKSPPTPANAQIYEAHV
GISSSEPRVGTYKEFTKNILPRIHKLGYNVIQLMAIMEHAYYASFGYQVTSFYAISSRYG
TPEDLKELIDTAHGMGITVLLDVVHSHACKNVDDGLNNFDGTDHQYFHGGAKGDHPQWDS
KLFDYGKYEVLRFLLSNLRFYIEEYHFDGFRFDGVTSMLYKHHGLGTGFSGGYHEYFGDE
HVDQQAVVYLMLAHELMRELQPLLRPGEDAGNFLSIAEDVSGMPALCRPVSEGGVGFDYR
LAMAIPDMWIKLVKETRDEDWDMGNIVFTLTNRRHREKTIAYAESHDQALVGDKTLAFWL
MDKEMYTSMSVLSDPNPIIDRGIALHKMIRLITHSLGGEGYLNFEGNEFGHPEWLDFPRE
GNGSSFHYCRRQWPVVDDKLLRYQHLNEFDAAMQHRGDHYGWLSADQAYVSLKNEDDKVV
VYERAGLVFVFNFHPNKSFTDYRIGVDQPGTYTLVLDSDSPEFGGFGRIDHEKTRCHTEP
LEWNGRANCMHIYIPSRVALVFAREDDPRRK
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgacactacaagtttgcaaagacgatccttggctcaaaccattcgaggaggaactcctt
cgacgacaagccctagtgggccagtggaaggaccattttgccaaggagggaggtcttgct
gagtttgcagcctcctataaacgatacggactccatgtcaacaaggacaactcggtcacc
tacagagagtgggctccaggagcctccgaagcagttctaaccggcgacttcaacggctgg
gacagacaacagtaccacatgaccagagacgagtatggactgtggagcgtgactgtgcct
cctacctcagatggtcaggtggcaatcccccataactccaaggtcaagcttgctctgaag
acctccaacggtcaatgggtcgatcgactgcctgcctggtccacctacgtcgtccaggac
ctgtccaaatcgcccatctatgaggctgtgttctggaaccctcccgagtcggaaaagtac
cagtggaagaacaaatctccccccactcctgccaacgcccaaatctacgaagcccacgtg
ggtatctcctccagcgaacctcgagtcggcacttacaaggagtttacaaagaacattctc
cctcgaatccacaaactgggctacaacgtgatccagctcatggccatcatggaacacgcc
tactacgcctcctttggctaccaggtcacctccttctacgctatttcgtcccgatatggt
actccagaggacctcaaggagctcattgacaccgctcacggtatgggtattactgttctt
ctggatgttgtgcactctcatgcttgcaaaaacgtcgatgacggtctcaacaactttgat
ggaactgaccaccagtacttccatggtggagcaaagggagaccatcctcagtgggactca
aagctgtttgattacggaaagtacgaggttcttcggttcttgctgtccaacctgcggttc
tatattgaggagtaccactttgacggcttccggtttgacggagtcacctctatgctctac
aagcatcatggtctcggtaccggcttctccggtggctaccatgagtactttggagacgaa
catgttgatcagcaggccgttgtttatctcatgttggctcacgagctcatgagggagctg
caacctcttcttcgacccggagaagatgcaggcaacttcctctccatcgccgaagatgtg
tctggaatgcctgctctctgtagacctgtttctgagggaggtgttggctttgactaccgt
ctggccatggctattcccgacatgtggatcaagctcgtcaaggagacccgagacgaggac
tgggacatgggcaacattgtttttactttgaccaaccgtcgtcatcgagaaaagaccatt
gcttatgctgagtctcatgatcaggctctggttggagacaaaactctggccttctggctc
atggataaggaaatgtacacctccatgtctgttctttccgaccccaaccccatcattgac
cgaggaatcgctctccacaagatgattcgactcatcacccattctcttggaggagaagga
tacctcaactttgagggtaacgagtttggacaccctgagtggctggacttccctcgagag
ggcaatggctcctctttccactactgtcgacgacagtggcctgtggtggatgacaagctg
ttgagataccagcatcttaatgaattcgatgccgccatgcagcaccgaggagaccactac
ggctggctgtcggccgaccaggcttacgtgtcgttgaagaacgaggacgacaaggtggtt
gtgtatgagcgagctggtctggtgtttgtcttcaacttccaccccaacaagtcgttcact
gactacagaatcggtgtggaccagcctggaacatacacccttgtgttggattctgattct
cccgagtttggaggttttggccgaatcgaccacgaaaagacccgatgccataccgagcct
ctggagtggaacggacgggctaactgtatgcatatctacattccttctcgagtggctctg
gtgtttgcccgggaggatgaccctagacgaaagtaa

DBGET integrated database retrieval system