KEGG   Yarrowia lipolytica: YALI0C08305gHelp
Entry
YALI0C08305g      CDS       T01033                                 

Definition
YALI0C08305p
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
yli  Yarrowia lipolytica
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:yli00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    YALI0C08305g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     YALI0C08305g
Protein kinases [BR:yli01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   YALI0C08305g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:1117028..1118020
Genome map
AA seq 330 aa AA seqDB search
MASLPNRSTVSKGKYSLTDFSIQRTLGTGSFGRVHLVRSVHNNRYYAIKVLKKAQIVKMK
QVEHTNDERRMLKLVEHPFLIRMWGTFQDSKNLFMVMDYVEGGELFSLLRKSQRFPNPVA
KFYAAEVTLALEYLHSHNIIYRDLKPENILLDKNGHIKITDFGFAKEVRDVTWTLCGTPD
YIAPEVVTTKAYNKSVDWWSLGILIYEMLTGYTPFYDHTPMKTYENILMGHVRYPSYLHP
DVTDLLTKLITKDLTRRYGNLQGGPQDVKNHPWFSEVIWEKLLSKDIETPYEPPIQSGVG
DTSLFDSYPEEELDYGIVCPDPYGKLFGDF
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctacctaacagaagcacggtttccaagggcaagtactcgttgacggacttc
tccatccagcgaacgcttggaacgggttcgttcggccgggtgcatctggttcggtcggtg
cacaacaaccggtactacgccatcaaggtgctgaaaaaggcgcagattgtgaagatgaag
caggtggagcacaccaacgacgagcggcggatgctcaagctggtggagcacccatttctg
atcagaatgtgggggacgttccaggactccaaaaacctgttcatggtgatggactacgtg
gagggaggcgagctgttctcgctgctgcgaaagagccagcggttccccaaccccgtggcc
aagttttatgcggcagaagtcaccctcgccctcgagtacctgcactcccacaacatcatc
taccgagacctcaagcccgaaaacattttgctagacaagaacggtcacatcaaaatcacg
gactttgggttcgccaaagaggtccgcgacgtgacctggacgctgtgtggcacgccagat
tacattgcgcccgaggtggtcaccacaaaggcgtacaacaagtctgtggactggtggtcg
ctcggaatcctcatttatgaaatgctcaccggctacacgcccttctacgaccacacgccc
atgaagacgtatgagaacattctcatgggtcatgtgcggtacccttcgtacctgcatccg
gatgtgactgatttgctgaccaaactcatcaccaaggacctcacccgacgatatggtaac
ctgcagggcggcccacaggacgtgaagaaccacccgtggttctccgaggtcatttgggag
aagttgttgtccaaggatatcgagactccgtatgagcctcccattcagagtggagtgggc
gacacgtcgttgtttgacagttacccggaggaggagctggactatggaattgtatgtccg
gacccgtatggaaagttgtttggcgatttctag

DBGET integrated database retrieval system