KEGG   Yarrowia lipolytica: YALI0C08305gHelp
Entry
YALI0C08305g      CDS       T01033                                 

Definition
(RefSeq) YALI0C08305p
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
yli  Yarrowia lipolytica
Pathway
yli04113  Meiosis - yeast
yli04138  Autophagy - yeast
yli04213  Longevity regulating pathway - multiple species
Module
yli_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:yli00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    YALI0C08305g
  Cell growth and death
   04113 Meiosis - yeast
    YALI0C08305g
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    YALI0C08305g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     YALI0C08305g
Protein kinases [BR:yli01001]
 Serine/threonine kinases: AGC group
  PKA family
   YALI0C08305g
Messenger RNA biogenesis [BR:yli03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YALI0C08305g
Chromosome and associated proteins [BR:yli03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    YALI0C08305g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 YrbL-PhoP_reg APH
Motif
Other DBs
NCBI-GeneID: 2909492
NCBI-ProteinID: XP_501593
UniProt: Q6CCL9
Position
C:1117028..1118020
Genome map
AA seq 330 aa AA seqDB search
MASLPNRSTVSKGKYSLTDFSIQRTLGTGSFGRVHLVRSVHNNRYYAIKVLKKAQIVKMK
QVEHTNDERRMLKLVEHPFLIRMWGTFQDSKNLFMVMDYVEGGELFSLLRKSQRFPNPVA
KFYAAEVTLALEYLHSHNIIYRDLKPENILLDKNGHIKITDFGFAKEVRDVTWTLCGTPD
YIAPEVVTTKAYNKSVDWWSLGILIYEMLTGYTPFYDHTPMKTYENILMGHVRYPSYLHP
DVTDLLTKLITKDLTRRYGNLQGGPQDVKNHPWFSEVIWEKLLSKDIETPYEPPIQSGVG
DTSLFDSYPEEELDYGIVCPDPYGKLFGDF
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctacctaacagaagcacggtttccaagggcaagtactcgttgacggacttc
tccatccagcgaacgcttggaacgggttcgttcggccgggtgcatctggttcggtcggtg
cacaacaaccggtactacgccatcaaggtgctgaaaaaggcgcagattgtgaagatgaag
caggtggagcacaccaacgacgagcggcggatgctcaagctggtggagcacccatttctg
atcagaatgtgggggacgttccaggactccaaaaacctgttcatggtgatggactacgtg
gagggaggcgagctgttctcgctgctgcgaaagagccagcggttccccaaccccgtggcc
aagttttatgcggcagaagtcaccctcgccctcgagtacctgcactcccacaacatcatc
taccgagacctcaagcccgaaaacattttgctagacaagaacggtcacatcaaaatcacg
gactttgggttcgccaaagaggtccgcgacgtgacctggacgctgtgtggcacgccagat
tacattgcgcccgaggtggtcaccacaaaggcgtacaacaagtctgtggactggtggtcg
ctcggaatcctcatttatgaaatgctcaccggctacacgcccttctacgaccacacgccc
atgaagacgtatgagaacattctcatgggtcatgtgcggtacccttcgtacctgcatccg
gatgtgactgatttgctgaccaaactcatcaccaaggacctcacccgacgatatggtaac
ctgcagggcggcccacaggacgtgaagaaccacccgtggttctccgaggtcatttgggag
aagttgttgtccaaggatatcgagactccgtatgagcctcccattcagagtggagtgggc
gacacgtcgttgtttgacagttacccggaggaggagctggactatggaattgtatgtccg
gacccgtatggaaagttgtttggcgatttctag

DBGET integrated database retrieval system