KEGG   Yarrowia lipolytica: YALI0C11231gHelp
Entry
YALI0C11231g      CDS       T01033                                 

Definition
YALI0C11231p
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     YALI0C11231g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:1547692..1549047
Genome map
AA seq 451 aa AA seqDB search
MDIATEWTTNANEALTITLEPSKGKGKGKEVSNGSEKSHVFNPIFTYPIYGDVETILGYK
NFELNLKMDASTMLPLVTVKFSDKLEFDGISFDDPVERLLEFLPEETATDEAEWEEKRVK
ELGDGFKPVGKEFGTFSVNSEKYTVHRSTLLDPETLKLHLRLQIFVPLFIEAGSYIDNED
DRWEIYIVYNAEKEIVGFSTVYCYWFYEPSAKESKAPKDASLEQLQKQPFSPTLRKRISQ
YVILPPFQGKGLGGQLYTLLFSRFYADPNVYEITVEDPSEAFDDLRDRCDLKWLADQGFP
SEVFRMLQTTSAHGEKAGDNRTGRTKVVAGAFWTKWLEEHRLKYKLAHRQFARCFEMILL
ACLEVSSPTKKRNIKDARLFIKKRVYVRNREFLEELGGKIEVMSKLQETYESMEEDYARI
MKPVLGYVKDGLKKRDRNDAGNEEAKRVKVE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgccacggaatggaccaccaacgccaatgaggcactcactatcacgctagag
ccgtccaagggcaagggcaagggcaaagaggtcagcaacggctccgagaagagccatgtc
ttcaaccccatcttcacctaccccatctacggagatgtagagaccatcctcggatacaag
aacttcgagctcaatttgaagatggacgcctctactatgctgccgctggtgacagtcaag
ttttccgacaagttggagtttgatggaatctcttttgacgaccctgtagagagattgctg
gagtttttgcccgaggaaaccgccaccgacgaggctgagtgggaggaaaagcgggtcaag
gagcttggcgacggcttcaagccggttggaaaggagtttggtaccttttcagtaaacagc
gagaaatacacagtccaccggtcaactctgcttgacccggagactctcaaattgcatctg
agactacagatcttcgtgcctctattcattgaggcgggctcatacattgacaacgaggat
gaccgctgggagatttacattgtgtacaacgcggagaaggagattgtcggattctccacc
gtatactgctactggttctacgagccttcggctaaggaaagcaaggctcccaaggacgcg
tcgttggagcagctccagaaacagccgttttcgcccacgcttcgaaagcgaatctcgcaa
tacgtcatcttgcctcctttccagggcaagggtctgggagggcagctgtacactctgttg
ttctctcgtttctacgccgaccctaatgtgtatgaaatcacagtcgaagaccccagtgaa
gcctttgacgatctgcgagatcgatgcgatctaaagtggctagcagaccagggattcccc
tcggaggtgttccggatgctgcagaccacttctgcacatggagagaaggctggagacaat
cgaactggccgaaccaaggtcgtggcaggcgcgttctggaccaaatggctagaggagcat
cgattgaagtacaagctggcccacagacagtttgctcggtgctttgaaatgattctccta
gcttgtctggaggtgtctagcccgacgaagaagcgaaatatcaaggacgcgcgacttttt
atcaaaaagcgagtctacgtgcgaaacagagagtttctggaggaactgggaggcaagata
gaagtcatgtccaaactgcaggagacatacgagtccatggaggaggattatgcccgaatc
atgaaacctgttctgggatatgtcaaggacggactcaagaaacgagaccgaaatgatgct
ggcaatgaagaggctaagagagtcaaggtggagtaa

DBGET integrated database retrieval system