KEGG   Yarrowia lipolytica: YALI0C11407gHelp
Entry
YALI0C11407g      CDS       T01033                                 

Definition
YALI0C11407p
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
yli  Yarrowia lipolytica
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    YALI0C11407g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YALI0C11407g
   00640 Propanoate metabolism
    YALI0C11407g
  Lipid metabolism
   00061 Fatty acid biosynthesis
    YALI0C11407g
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    YALI0C11407g
Enzymes [BR:yli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     YALI0C11407g
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     YALI0C11407g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:join(1578157..1578197,1578304..1578469,1578833..1585426)
Genome map
AA seq 2266 aa AA seqDB search
MRLQLRTLTRRFFSMASGSSTPDVAPLVDPNIHKGLASHFFGLNSVHTAKPSKVKEFVAS
HGGHTVINKVLIANNGIAAVKEIRSVRKWAYETFGDERAISFTVMATPEDLAANADYIRM
ADQYVEVPGGTNNNNYANVELIVDVAERFGVDAVWAGWGHASENPLLPESLAASPRKIVF
IGPPGAAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVVVDKSTNLVSVSEEVYTKGCT
TGPKQGLEKAKQIGFPVMIKASEGGGGKGIRKVEREEDFEAAYHQVEGEIPGSPIFIMQL
AGNARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTVAGQQTFTAMEKAAVRL
GKLVGYVSAGTVEYLYSHEDDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPL
DRIKDIRLFYGVNPHTTTPIDFDFSGEDADKTQRRPVPRGHTTACRITSEDPGEGFKPSG
GTMHELNFRSSSNVWGYFSVGNQGGIHSFSDSQFGHIFAFGENRSASRKHMVVALKELSI
RGDFRTTVEYLIKLLETPDFEDNTITTGWLDELISNKLTAERPDSFLAVVCGAATKAHRA
SEDSIATYMASLEKGQVPARDILKTLFPVDFIYEGQRYKFTATRSSEDSYTLFINGSRCD
IGVRPLSDGGILCLVGGRSHNVYWKEEVGATRLSVDSKTCLLEVENDPTQLRSPSPGKLV
KFLVENGDHVRANQPYAEIEVMKMYMTLTAQEDGIVQLMKQPGSTIEAGDILGILALDDP
SKVKHAKPFEGQLPELGPPTLSGNKPHQRYEHCQNVLHNILLGFDNQVVMKSTLQEMVGL
LRNPELPYLQWAHQVSSLHTRMSAKLDATLAGLIDKAKQRGGEFPAKQLLRALEKEASSG
EVDALFQQTLAPLFDLAREYQDGLAIHELQVAAGLLQAYYDSEARFCGPNVRDEDVILKL
REENRDSLRKVVMAQLSHSRVGAKNNLVLALLDEYKVADQAGTDSPASNVHVAKYLRPVL
RKIVELESRASAKVSLKAREILIQCALPSLKERTDQLEHILRSSVVESRYGEVGLEHRTP
RADILKEVVDSKYIVFDVLAQFFAHDDPWIVLAALELYIRRACKAYSILDINYHQDSDLP
PVISWRFRLPTMSSALYNSVVSSGSKTPTSPSVSRADSVSDFSYTVERDSAPARTGAIVA
VPHLDDLEDALTRVLENLPKRGAGLAISVGASNKSAAASARDAAAAAASSVDTGLSNICN
VMIGRVDESDDDDTLIARISQVIEDFKEDFEACSLRRITFSFGNSRGTYPKYFTFRGPAY
EEDPTIRHIEPALAFQLELARLSNFDIKPVHTDNRNIHVYEATGKNAASDKRFFTRGIVR
PGRLRENIPTSEYLISEADRLMSDILDALEVIGTTNSDLNHIFINFSAVFALKPEEVEAA
FGGFLERFGRRLWRLRVTGAEIRMMVSDPETGSAFPLRAMINNVSGYVVQSELYAEAKND
KGQWIFKSLGKPGSMHMRSINTPYPTKEWLQPKRYKAHLMGTTYCYDFPELFRQSIESDW
KKYDGKAPDDLMTCNELILDEDSGELQEVNREPGANNVGMVAWKFEAKTPEYPRGRSFIV
VANDITFQIGSFGPAEDQFFFKVTELARKLGIPRIYLSANSGARIGIADELVGKYKVAWN
DETDPSKGFKYLYFTPESLATLKPDTVVTTEIEEEGPNGVEKRHVIDYIVGEKDGLGVEC
LRGSGLIAGATSRAYKDIFTLTLVTCRSVGIGAYLVRLGQRAIQIEGQPIILTGAPAINK
LLGREVYSSNLQLGGTQIMYNNGVSHLTARDDLNGVHKIMQWLSYIPASRGLPVPVLPHK
TDVWDRDVTFQPVRGEQYDVRWLISGRTLEDGAFESGLFDKDSFQETLSGWAKGVVVGRA
RLGGIPFGVIGVETATVDNTTPADPANPDSIEMSTSEAGQVWYPNSAFKTSQAINDFNHG
EALPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYKQPIMVYIPPTGELRGGSWVV
VDPTINSDMMEMYADVESRGGVLEPEGMVGIKYRRDKLLDTMARLDPEYSSLKKQLEESP
DSEELKVKLSVREKSLMPIYQQISVQFADLHDRAGRMEAKGVIREALVWKDARRFFFWRI
RRRLVEEYLITKINSILPSCTRLECLARIKSWKPATLDQGSDRGVAEWFDENSDAVSARL
SELKKDASAQSFASQLRKDRQGTLQGMKQALASLSEAERAELLKGL
NT seq 6801 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgcaattgaggacactaacacgtcggtttttcagtatggcttcaggatcttca
acgccagatgtggctcccttggtggaccccaacattcacaaaggtctcgcctctcatttc
tttggactcaattctgtccacacagccaagccctcaaaagtcaaggagtttgtggcttct
cacggaggtcatacagttatcaacaaggtcctcatcgctaacaacggtattgccgcagta
aaggagatccgttcagtacgaaaatgggcctacgagacctttggcgacgagcgagcaatc
tcgttcaccgtcatggccacccccgaagatctcgctgccaacgccgactacattagaatg
gccgatcagtacgtcgaggtgcccggaggaaccaacaacaacaactacgccaacgtcgag
ctgattgtcgacgtggctgagcgattcggcgtcgatgccgtgtgggccggatggggccat
gccagtgaaaatcccctgctccccgagtcgctagcggcctctccccgcaagattgtcttc
atcggccctcccggagctgccatgagatctctgggagacaaaatttcttctaccattgtg
gcccagcacgcaaaggtcccgtgtatcccgtggtctggaaccggagtggacgaggttgtg
gttgacaagagcaccaacctcgtgtccgtgtccgaggaggtgtacaccaagggctgcacc
accggtcccaagcagggtctggagaaggctaagcagattggattccccgtgatgatcaag
gcttccgagggaggaggaggaaagggtattcgaaaggttgagcgagaggaggacttcgag
gctgcttaccaccaggtcgagggagagatccccggctcgcccatcttcattatgcagctt
gcaggcaatgcccggcatttggaggtgcagcttctggctgatcagtacggcaacaatatt
tcactgtttggtcgagattgttcggttcagcgacggcatcaaaagattattgaggaggct
cctgtgactgtggctggccagcagaccttcactgccatggagaaggctgccgtgcgactc
ggtaagcttgtcggatatgtctctgcaggtaccgttgaatatctgtattcccatgaggac
gacaagttctacttcttggagctgaatcctcgtcttcaggtcgaacatcctaccaccgag
atggtcaccggtgtcaacctgcccgctgcccagcttcagatcgccatgggtatccccctc
gatcgaatcaaggacattcgtctcttttacggtgttaaccctcacaccaccactccaatt
gatttcgacttctcgggcgaggatgctgataagacacagcgacgtcccgtcccccgaggt
cacaccactgcttgccgaatcacatccgaggaccctggagagggtttcaagccctccgga
ggtactatgcacgagctcaacttccgatcctcgtccaacgtgtggggttacttctccgtt
ggtaaccagggaggtatccattcgttctcggattcgcagtttggtcacatcttcgccttc
ggtgagaaccgaagtgcgtctcgaaagcacatggttgttgctttgaaggaactatctatt
cgaggtgacttccgaaccaccgtcgagtacctcatcaagctgctggagacaccggacttc
gaggacaacaccatcaccaccggctggctggatgagcttatctccaacaagctgactgcc
gagcgacccgactcgttcctcgctgttgtttgtggtgctgctaccaaggcccatcgagct
tccgaggactctattgccacctacatggcttcgctagagaagggccaggtccctgctcga
gacattctcaagacccttttccccgttgacttcatctacgagggccagcggtacaagttc
accgccacccggtcgtctgaggactcttacacgctgttcatcaacggttctcgatgcgac
attggagttagacctctttctgacggtggtattctgtgtcttgtaggtgggagatcccac
aatgtctactggaaggaggaggttggagccacgcgactgtctgttgactccaagacctgc
cttctcgaggtggagaacgaccccactcagcttcgatctccctctcccggtaagctggtt
aagttcctggtcgagaacggcgaccacgtgcgagccaaccagccctatgccgagattgag
gtcatgaagatgtacatgactctcactgctcaggaggacggtattgtccagctgatgaag
cagcccggttccaccatcgaggctggcgacatcctcggtatcttggcccttgatgatcct
tccaaggtcaagcatgccaagccctttgagggccagcttcccgagcttggaccccccact
ctcagcggtaacaagcctcatcagcgatacgagcactgccagaacgtgctccataacatt
ctgcttggtttcgataaccaggtggtgatgaagtccactcttcaggagatggttggtctg
ctccgaaaccctgagcttccttatctccagtgggctcatcaggtgtcttctctgcacacc
cgaatgagcgccaagctggatgctactcttgctggtctcattgacaaggccaagcagcga
ggtggcgagtttcctgccaagcagcttctgcgagcccttgagaaggaggcgagctctggc
gaggtcgatgcgctcttccagcaaactcttgctcctctgtttgaccttgctcgagagtac
caggacggtcttgctatccacgagcttcaggttgctgcaggccttctgcaggcctactac
gactctgaggcccggttctgcggacccaacgtacgtgacgaggatgtcattctcaagctt
cgagaggagaaccgagattctcttcgaaaggttgtgatggcccagctgtctcattctcga
gtcggagccaagaacaaccttgtgctggcccttctcgatgaatacaaggtggccgaccag
gctggcaccgactctcctgcctccaacgtgcacgttgcaaagtacttgcgacctgtgctg
cgaaagattgtggagctggaatctcgagcttctgccaaggtatctctgaaagcccgagag
attctcatccagtgcgctctgccctctctaaaggagcgaactgaccagcttgagcacatt
ctgcgatcttctgtcgtcgagtctcgatacggagaggttggtctggagcaccgaactccc
cgagccgatattctcaaggaggttgtcgactccaagtacattgtctttgatgtgcttgcc
cagttctttgcccacgatgatccctggatcgtccttgctgccctggagctgtacatccga
cgagcttgcaaggcctactccatcctggacatcaactaccaccaggactcggacctgcct
cccgtcatctcgtggcgatttagactgcctaccatgtcgtctgctttgtacaactcagta
gtgtcttctggctccaaaacccccacttccccctcggtgtctcgagctgattccgtctcc
gacttttcgtacaccgttgagcgagactctgctcccgctcgaaccggagcgattgttgcc
gtgcctcatctggatgatctggaggatgctctgactcgtgttctggagaacctgcccaaa
cggggcgctggtcttgccatctctgttggtgctagcaacaagagtgccgctgcttctgct
cgtgacgctgctgctgctgccgcttcatccgttgacactggcctgtccaacatttgcaac
gttatgattggtcgggttgatgagtctgatgacgacgacactctgattgcccgaatctcc
caggtcattgaggactttaaggaggactttgaggcctgttctctgcgacgaatcaccttc
tccttcggcaactcccgaggtacttatcccaagtatttcacgttccgaggccccgcatac
gaggaggaccccactatccgacacattgagcctgctctggccttccagctggagctcgcc
cgtctgtccaacttcgacatcaagcctgtccacaccgacaaccgaaacatccacgtgtac
gaggctactggcaagaacgctgcttccgacaagcggttcttcacccgaggtatcgtacga
cctggtcgtcttcgagagaacatccccacctcggagtatctcatttccgaggctgaccgg
ctcatgagcgatattttggacgctctagaggtgattggaaccaccaactcggatctcaac
cacattttcatcaacttctcagccgtctttgctctgaagcccgaggaggttgaagctgcc
tttggcggtttcctggagcgatttggccgacgtctgtggcgacttcgagtcaccggtgcc
gagatccgaatgatggtatccgaccccgaaactggctctgctttccctctgcgagcaatg
atcaacaacgtctctggttacgttgtgcagtctgagctgtacgctgaggccaagaacgac
aagggccagtggattttcaagtctctgggcaagcccggctccatgcacatgcggtctatc
aacactccctaccccaccaaggagtggctgcagcccaagcggtacaaggcccatctgatg
ggtaccacctactgctatgacttccccgagctgttccgacagtccattgagtcggactgg
aagaagtatgacggcaaggctcccgacgatctcatgacttgcaacgagctgattctcgat
gaggactctggcgagctgcaggaggtgaaccgagagcccggcgccaacaacgtcggtatg
gttgcgtggaagtttgaggccaagacccccgagtaccctcgaggccgatctttcatcgtg
gtggccaacgatatcaccttccagattggttcgtttggccctgctgaggaccagttcttc
ttcaaggtgacggagctggctcgaaagctcggtattcctcgaatctatctgtctgccaac
tctggtgctcgaatcggcattgctgacgagctcgttggcaagtacaaggttgcgtggaac
gacgagactgacccctccaagggcttcaagtacctttacttcacccctgagtctcttgcc
accctcaagcccgacactgttgtcaccactgagattgaggaggagggtcccaacggcgtg
gagaagcgtcatgtgatcgactacattgtcggagagaaggacggtctcggagtcgagtgt
ctgcggggctctggtctcattgcaggcgccacttctcgagcctacaaggatatcttcact
ctcactcttgtcacctgtcgatccgttggtatcggtgcttaccttgttcgtcttggtcaa
cgagccatccagattgagggccagcccatcattctcactggtgcccccgccatcaacaag
ctgcttggtcgagaggtctactcttccaacttgcagcttggtggtactcagatcatgtac
aacaacggtgtgtctcatctgactgcccgagatgatctcaacggtgtccacaagatcatg
cagtggctgtcatacatccctgcttctcgaggtcttccagtgcctgttctccctcacaag
accgatgtgtgggatcgagacgtgacgttccagcctgtccgaggcgagcagtacgatgtt
agatggcttatttctggccgaactctcgaggatggtgctttcgagtctggtctctttgac
aaggactctttccaggagactctgtctggctgggccaagggtgttgttgttggtcgagct
cgtcttggcggcattcccttcggtgtcattggtgtcgagactgcgaccgtcgacaatact
acccctgccgatcccgccaacccggactctattgagatgagcacctctgaagccggccag
gtttggtaccccaactcggccttcaagacctctcaggccatcaacgacttcaaccatggt
gaggcgcttcctctcatgattcttgctaactggcgaggcttttctggtggtcagcgagac
atgtacaatgaggttctcaagtacggatctttcattgttgatgctctggttgactacaag
cagcccatcatggtgtacatccctcccaccggtgagctgcgaggtggttcttgggttgtg
gttgaccccaccatcaactcggacatgatggagatgtacgctgacgtcgagtctcgaggt
ggtgtgctggagcccgagggaatggtcggtatcaagtaccgacgagacaagctactggac
accatggctcgtctggatcccgagtactcctctctcaagaagcagcttgaggagtctccc
gattctgaggagctcaaggtcaagctcagcgtgcgagagaagtctctcatgcccatctac
cagcagatctccgtgcagtttgccgacttgcatgaccgagctggccgaatggaggccaag
ggtgtcattcgtgaggctcttgtgtggaaggatgctcgtcgattcttcttctggcgaatc
cgacgacgattagtcgaggagtacctcattaccaagatcaatagcattctgccctcttgc
actcggcttgagtgtctggctcgaatcaagtcgtggaagcctgccactcttgatcagggc
tctgaccggggtgttgccgagtggtttgacgagaactctgatgccgtctctgctcgactc
agcgagctcaagaaggacgcttctgcccagtcgtttgcttctcaactgagaaaggaccga
cagggtactctccagggcatgaagcaggctctcgcttctctttctgaggctgagcgggct
gagctgctcaaggggttgtga

DBGET integrated database retrieval system