KEGG   Yarrowia lipolytica: YALI0C11649gHelp
Entry
YALI0C11649g      CDS       T01033                                 

Definition
YALI0C11649p
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
yli  Yarrowia lipolytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:1609522..1611564
Genome map
AA seq 680 aa AA seqDB search
MPPGLTTSHLQDWLSSVSNSFLASYSQLDEDLAAVSSSVATVAQPHWWSVLYAQVVAFLH
KHLLPQHRPSISTLITTTATTSLCIYIFAPSLLPDRMFSVFSSRSKRPGRYTVGLVNLAN
DCFANSNLQALASLRSLLLYIDEAMLVGIPQENLLNNSRKNNYPVDAKGKQYLRLTRALG
SMIMELNEPVKNPKTVSPWKFLVILEQIYNSRISRNQHDAHELLHLILECLSNEYEAAVK
DGILRPGQHSSDRESVASSSIPEADIGTDFLPPAAPTPQSAVTDPEMLASFPFEGSTIDR
IACSRCGYLPPVQSTNFLVLSLMVPQKRHASLTDLIDRMTAPEYIKDYGCVSCRLKAVSS
NPSAFIGTGINGSKAKYTPELVEQLSSYSAKIDQLPEELEEALPKNITSPISKSTRFSKL
PLILSLHLSRSIYSGDNASRNSCKVSCPEFIDLYESNPNVRSREDSPGEEGDALASGLKS
LKAKKRVKYRLVAMIRHNGTHYTGHYECYRRKNLTWWKGCIQRYSKRAGGDKNGMEKEGG
VAVPRSGSEPPEISVDTTIPSPSLSASQPSPVSKAAASTSSTSYVTHSNSSSYSDLKGLD
TGTTENTSPDEADEGEESQLVESLYSTLVLNNGNSTGGPNVGKYEWWRISDDSIWECHTK
DVLKEESGAYLLFYEQCIES
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcccccagggctgacgacttctcatcttcaggactggctttcgtctgtgtcaaactcc
tttctcgccagttactcgcagctcgacgaggaccttgcagccgtttcttcgtctgtcgcc
accgtggcccaacctcactggtggtccgttctgtacgctcaggtagtggcatttctacac
aaacaccttctcccgcaacatagaccgtccatatcgactcttatcaccaccaccgccacc
acctcgctctgcatctacatttttgcgccctccctgctccccgatcgcatgttttctgtc
tttagctcgcgttcgaaacgcccaggacgatacacagttggtctggtgaacctggccaat
gattgctttgcaaactcgaatttgcaggctctggcctcgctacgatcgctgctgctgtat
attgacgaggccatgttagtgggaatcccccaagagaacctgctgaacaactcgcgcaaa
aacaattatccggtcgatgccaagggcaagcagtacttgagactgacacgagcactgggg
tccatgatcatggagcttaacgagcccgtcaagaaccccaagactgtgtccccgtggaag
tttcttgttattctcgaacaaatctacaactcgcggatcagtcgcaaccagcatgatgct
cacgaactcttgcatctcattctcgaatgtctctcaaacgagtacgaagctgccgtgaag
gatggtattctgcgaccgggacagcacagcagtgacagagaaagcgtcgccagcagctcg
atccccgaggcagacattgggaccgactttttgcctcctgcagcaccgacaccccagtcg
gcagtcacagacccggaaatgcttgcatcattcccatttgaaggatccaccatcgacaga
attgcctgttcgcgttgtggatacctcccgcctgtacagtcgaccaattttctcgtcttg
tctctcatggttccccaaaagcgacatgccagtctcacagacctcattgatcgcatgacc
gctccagaatacatcaaagactacggatgtgtgtcgtgcagactcaaggcggtttcttcc
aacccttctgcatttattggaaccgggatcaatggctcaaaggccaagtacactcccgag
ctggtggaacagctgagttcctactcagccaagattgatcagctgcccgaggagcttgag
gaggctcttccaaagaacatcacctcgcctatctccaaatccacacggttctcaaagctg
ccgctcattttgtctctgcatctgtctcgatccatctactctggtgacaacgcgtctcga
aacagttgcaaggtgagctgtcctgagttcattgacttgtatgagagcaatcccaacgtg
cggtcgcgcgaggactctcctggagaagaaggcgatgctcttgcctcgggtctcaaatcg
ctcaaggccaagaaacgcgtcaagtaccgcctggtggccatgattcgacacaacggtacg
cactacacgggacattacgagtgctatcgacgcaagaacctcacgtggtggaagggatgc
attcagcgatactccaagcgagctggaggtgataagaatggtatggagaaggaaggtgga
gtggcggttccgagaagtggatctgaacctccagaaatctctgtggacaccaccattccc
tctccatctctgtctgcgtctcagccgtcgcctgtgtcaaaggccgccgcttccacgtca
tctaccagttatgtcactcattccaacagttctagttatagcgacctcaagggtctcgat
accggcaccactgagaacacctcacccgacgaagccgacgagggtgaggaatcgcagctg
gtggagtcgttgtactcgaccctggtcttgaataatgggaactctactggtggaccaaat
gtgggcaagtacgaatggtggagaatcagtgatgatagtatctgggaatgccatactaag
gacgtgttgaaggaggaaagtggtgcttatctgttgttttatgaacagtgcattgagtcc
taa

DBGET integrated database retrieval system