KEGG   Yarrowia lipolytica: YALI0C12386gHelp
Entry
YALI0C12386g      CDS       T01033                                 

Definition
YALI0C12386p
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
yli  Yarrowia lipolytica
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YALI0C12386g
Enzymes [BR:yli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YALI0C12386g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:1735704..1736798
Genome map
AA seq 364 aa AA seqDB search
MRFTTLFTLATAAMASLIDLTDKTFEKSVLNADHPTLVKFYAPWCGHCKKMGPDYDQLAS
VYAHTDDVEIARYNGDENRKFSKKYGIQGFPTLKWFPGKGADPVDYESGRDFDSLVQFVQ
SKSGVKAKTAPKSEGAKLIKTVDDQSFADLFKNDKKYALVAFTAKWCGYCKQLAPEYEKV
AAVFSRDPVSIGQVDCTEPEPSHDLLEKYDIKSYPTLLWFEEGSTEPVKFEGGDRSVEGL
VAFINDKTGLNRNTDGSYNDYAGVFSGKLLEQLKEAVENPTKVKEFIGEIPQSFSSVYER
VLSKVGSLGEETEAYLDKEITRLGNIIEKRGAKQDKLDEFKIRQNVLKSIKALKNKVENV
RDEL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcaccaccctgttcacgctggccaccgcggccatggcgtcgctgatcgatctg
accgacaagacgtttgagaagtccgtgctcaatgccgaccaccccacgctggtcaagttc
tacgctccctggtgcggccactgcaagaagatgggccctgactacgaccaattggcgtcc
gtgtacgcgcacactgacgacgtggagattgcacgatacaacggcgacgaaaaccgaaaa
ttctccaaaaagtacggcatccagggcttccctaccctcaagtggttccccggcaagggg
gccgatccggtggactacgaatctggccgagactttgactctctggtgcagtttgtgcaa
tccaaatccggcgtcaaggccaagaccgcccccaagtccgagggcgctaagctgatcaag
accgtcgacgaccagtcctttgccgacctgttcaagaacgacaagaagtacgccctggtc
gccttcaccgccaagtggtgtggatactgcaagcagctggcgcccgagtacgaaaaggtg
gcggctgtcttctcccgagaccccgtttccattggacaggttgactgcactgagcccgag
ccttcccacgatctgctggagaaatacgacatcaagtcctaccccacgctcctctggttc
gaggagggtagcaccgagcccgtcaaatttgagggtggcgaccggtctgtcgagggtctc
gttgcttttattaatgacaagactggcctcaaccgaaacactgacggctcctacaacgat
tacgccggtgtgttcagcggcaagctactggagcagctcaaggaggctgtggagaacccc
accaaggtcaaggagttcatcggcgagatcccccagtctttctcttccgtctacgagcga
gttctcagcaaggtcggttctctaggagaggagacagaggcttacctcgacaaggagatt
acccgactgggtaacatcattgagaagcggggtgccaagcaggacaagctggacgagttc
aagatccgacagaacgttctcaagtctatcaaggcgcttaagaacaaggtcgagaacgtc
cgagatgagctttag

DBGET integrated database retrieval system