KEGG   Yarrowia lipolytica: YALI0C12771gHelp
Entry
YALI0C12771g      CDS       T01033                                 

Definition
YALI0C12771p
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
yli  Yarrowia lipolytica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:yli00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:yli00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:complement(1773531..1774100)
Genome map
AA seq 189 aa AA seqDB search
MPPSTTLILAATVPRYGIGLNGGLPWRLAKEMKFFKQVTTAQKNAVVIMGRTTWDSIPPK
FRPLPDRTNIVLTSRPMTDAPEEVVVARSFDEALTKCPEDSTVYVIGGSQVYKTALVHEH
TKAVLLTEITCPDGHVECDTFFEGFDQGLWKKQPYERLQDFVGDKVELPGRDTPVEEKGF
SFVYTLWEK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcctccttcaactacgctcattctggcagccacagtgccccgatatggcatcggactc
aatggaggacttccatggagactagccaaagaaatgaagttcttcaaacaggtgactaca
gcccagaagaacgccgtcgtcatcatgggacgaaccacctgggactccattccccccaag
ttcagacctcttcctgatcgaaccaacattgttctcacttctagacccatgactgacgct
cccgaggaggttgtagtcgcccggtcgttcgacgaagcgcttacaaagtgccccgaggat
tctaccgtttacgtcatcggcggatctcaggtttacaagaccgcgctggtccacgaacat
acaaaggccgtgcttttgacagaaattacctgtcccgacggccacgtggaatgtgacacc
ttcttcgagggctttgaccagggtctgtggaagaagcagccttatgaacgtctccaagac
tttgtgggagacaaggtggagcttcctggacgagatactcctgtggaagagaagggcttt
tctttcgtttacaccttgtgggagaaataa

DBGET integrated database retrieval system